Showing 200 of total 1520 results (show query)
sportsdataverse
hoopR:Access Men's Basketball Play by Play Data
A utility to quickly obtain clean and tidy men's basketball play by play data. Provides functions to access live play by play and box score data from ESPN<https://www.espn.com> with shot locations when available. It is also a full NBA Stats API<https://www.nba.com/stats/> wrapper. It is also a scraping and aggregating interface for Ken Pomeroy's men's college basketball statistics website<https://kenpom.com>. It provides users with an active subscription the capability to scrape the website tables and analyze the data for themselves.
Maintained by Saiem Gilani. Last updated 1 years ago.
basketballcollege-basketballespnkenpomnbanba-analyticsnba-apinba-datanba-statisticsnba-statsnba-stats-apincaancaa-basketballncaa-bracketncaa-playersncaa-ratingsncaamsportsdataverse
283.1 match 91 stars 6.93 score 261 scriptssportsdataverse
wehoop:Access Women's Basketball Play by Play Data
A utility for working with women's basketball data. A scraping and aggregating interface for the WNBA Stats API <https://stats.wnba.com/> and ESPN's <https://www.espn.com> women's college basketball and WNBA statistics. It provides users with the capability to access the game play-by-plays, box scores, standings and results to analyze the data for themselves.
Maintained by Saiem Gilani. Last updated 8 months ago.
college-basketballespnespn-statsncaancaa-basketballprofessional-basketball-datasportsdataversewnbawnba-playerswnba-statswomens-basketball
212.7 match 31 stars 5.40 score 54 scriptsmichelnivard
gptstudio:Use Large Language Models Directly in your Development Environment
Large language models are readily accessible via API. This package lowers the barrier to use the API inside of your development environment. For more on the API, see <https://platform.openai.com/docs/introduction>.
Maintained by James Wade. Last updated 6 days ago.
chatgptgpt-3rstudiorstudio-addin
73.2 match 930 stars 10.85 score 43 scripts 1 dependentsropensci
googleLanguageR:Call Google's 'Natural Language' API, 'Cloud Translation' API, 'Cloud Speech' API and 'Cloud Text-to-Speech' API
Call 'Google Cloud' machine learning APIs for text and speech tasks. Call the 'Cloud Translation' API <https://cloud.google.com/translate/> for detection and translation of text, the 'Natural Language' API <https://cloud.google.com/natural-language/> to analyse text for sentiment, entities or syntax, the 'Cloud Speech' API <https://cloud.google.com/speech/> to transcribe sound files to text and the 'Cloud Text-to-Speech' API <https://cloud.google.com/text-to-speech/> to turn text into sound files.
Maintained by Mark Edmondson. Last updated 9 months ago.
cloud-speech-apicloud-translation-apigoogle-api-clientgoogle-cloudgoogle-cloud-speechgoogle-nlpgoogleauthrnatural-language-processingpeer-reviewedsentiment-analysisspeech-apitranslation-api
66.0 match 196 stars 10.36 score 268 scripts 3 dependentsedubruell
tidyllm:Tidy Integration of Large Language Models
A tidy interface for integrating large language model (LLM) APIs such as 'Claude', 'Openai', 'Gemini','Mistral' and local models via 'Ollama' into R workflows. The package supports text and media-based interactions, interactive message history, batch request APIs, and a tidy, pipeline-oriented interface for streamlined integration into data workflows. Web services are available at <https://www.anthropic.com>, <https://openai.com>, <https://aistudio.google.com/>, <https://mistral.ai/> and <https://ollama.com>.
Maintained by Eduard Brüll. Last updated 4 days ago.
84.7 match 70 stars 7.87 score 26 scriptsmunterfi
hereR:'sf'-Based Interface to the 'HERE' REST APIs
Interface to the 'HERE' REST APIs <https://developer.here.com/develop/rest-apis>: (1) geocode and autosuggest addresses or reverse geocode POIs using the 'Geocoder' API; (2) route directions, travel distance or time matrices and isolines using the 'Routing', 'Matrix Routing' and 'Isoline Routing' APIs; (3) request real-time traffic flow and incident information from the 'Traffic' API; (4) find request public transport connections and nearby stations from the 'Public Transit' API; (5) request intermodal routes using the 'Intermodal Routing' API; (6) get weather forecasts, reports on current weather conditions, astronomical information and alerts at a specific location from the 'Destination Weather' API. Locations, routes and isolines are returned as 'sf' objects.
Maintained by Merlin Unterfinger. Last updated 1 months ago.
apigeocodinggishere-technologiesisolineroutingrspatialtrafficweather
70.7 match 91 stars 8.70 score 63 scriptsmarkedmondson1234
googleAuthR:Authenticate and Create Google APIs
Create R functions that interact with OAuth2 Google APIs <https://developers.google.com/apis-explorer/> easily, with auto-refresh and Shiny compatibility.
Maintained by Erik Grönroos. Last updated 10 months ago.
apiauthenticationgooglegoogleauthroauth2-flowshiny
47.8 match 178 stars 12.85 score 804 scripts 13 dependentsstevenmmortimer
salesforcer:An Implementation of 'Salesforce' APIs Using Tidy Principles
Functions connecting to the 'Salesforce' Platform APIs (REST, SOAP, Bulk 1.0, Bulk 2.0, Metadata, Reports and Dashboards) <https://trailhead.salesforce.com/content/learn/modules/api_basics/api_basics_overview>. "API" is an acronym for "application programming interface". Most all calls from these APIs are supported as they use CSV, XML or JSON data that can be parsed into R data structures. For more details please see the 'Salesforce' API documentation and this package's website <https://stevenmmortimer.github.io/salesforcer/> for more information, documentation, and examples.
Maintained by Steven M. Mortimer. Last updated 5 months ago.
api-wrappersr-languager-programmingsalesforcesalesforce-apis
61.5 match 82 stars 9.27 score 191 scriptseblondel
geosapi:GeoServer REST API R Interface
Provides an R interface to the GeoServer REST API, allowing to upload and publish data in a GeoServer web-application and expose data to OGC Web-Services. The package currently supports all CRUD (Create,Read,Update,Delete) operations on GeoServer workspaces, namespaces, datastores (stores of vector data), featuretypes, layers, styles, as well as vector data upload operations. For more information about the GeoServer REST API, see <https://docs.geoserver.org/stable/en/user/rest/>.
Maintained by Emmanuel Blondel. Last updated 30 days ago.
apigeoservergispublicationrestspatial
83.5 match 34 stars 5.75 score 33 scriptsjozefhajnala
nhlapi:A Minimum-Dependency 'R' Interface to the 'NHL' API
Retrieves and processes the data exposed by the open 'NHL' API. This includes information on players, teams, games, tournaments, drafts, standings, schedules and other endpoints. A lower-level interface to access the data via URLs directly is also provided.
Maintained by Jozef Hajnala. Last updated 4 years ago.
73.7 match 29 stars 6.00 score 23 scriptsropensci
taxize:Taxonomic Information from Around the Web
Interacts with a suite of web application programming interfaces (API) for taxonomic tasks, such as getting database specific taxonomic identifiers, verifying species names, getting taxonomic hierarchies, fetching downstream and upstream taxonomic names, getting taxonomic synonyms, converting scientific to common names and vice versa, and more. Some of the services supported include 'NCBI E-utilities' (<https://www.ncbi.nlm.nih.gov/books/NBK25501/>), 'Encyclopedia of Life' (<https://eol.org/docs/what-is-eol/data-services>), 'Global Biodiversity Information Facility' (<https://techdocs.gbif.org/en/openapi/>), and many more. Links to the API documentation for other supported services are available in the documentation for their respective functions in this package.
Maintained by Zachary Foster. Last updated 27 days ago.
taxonomybiologynomenclaturejsonapiwebapi-clientidentifiersspeciesnamesapi-wrapperbiodiversitydarwincoredatataxize
32.3 match 274 stars 13.63 score 1.6k scripts 23 dependentsrstudio
plumber:An API Generator for R
Gives the ability to automatically generate and serve an HTTP API from R functions using the annotations in the R documentation around your functions.
Maintained by Barret Schloerke. Last updated 20 days ago.
29.8 match 1.4k stars 14.47 score 2.2k scripts 16 dependentsropensci
rdhs:API Client and Dataset Management for the Demographic and Health Survey (DHS) Data
Provides a client for (1) querying the DHS API for survey indicators and metadata (<https://api.dhsprogram.com/#/index.html>), (2) identifying surveys and datasets for analysis, (3) downloading survey datasets from the DHS website, (4) loading datasets and associate metadata into R, and (5) extracting variables and combining datasets for pooled analysis.
Maintained by OJ Watson. Last updated 1 months ago.
datasetdhsdhs-apiextractpeer-reviewedsurvey-data
42.3 match 37 stars 10.16 score 286 scripts 4 dependentsusepa
ctxR:Utilities for Interacting with the 'CTX' APIs
Access chemical, hazard, bioactivity, and exposure data from the Computational Toxicology and Exposure ('CTX') APIs <https://www.epa.gov/comptox-tools/computational-toxicology-and-exposure-apis>. 'ctxR' was developed to streamline the process of accessing the information available through the 'CTX' APIs without requiring prior knowledge of how to use APIs. Most data is also available on the CompTox Chemical Dashboard ('CCD') <https://comptox.epa.gov/dashboard/> and other resources found at the EPA Computational Toxicology and Exposure Online Resources <https://www.epa.gov/comptox-tools>.
Maintained by Paul Kruse. Last updated 2 months ago.
53.8 match 10 stars 7.97 score 13 scripts 1 dependentsgshs-ornl
wbstats:Programmatic Access to Data and Statistics from the World Bank API
Search and download data from the World Bank Data API.
Maintained by Jesse Piburn. Last updated 4 years ago.
open-dataworld-bankworld-bank-apiworldbank
37.3 match 126 stars 10.07 score 1.1k scripts 3 dependentsjestonblu
RobinHood:Interface for the RobinHood.com No Commission Investing Platform
Execute API calls to the RobinHood <https://robinhood.com> investing platform. Functionality includes accessing account data and current holdings, retrieving investment statistics and quotes, placing and canceling orders, getting market trading hours, searching investments by popular tag, and interacting with watch lists.
Maintained by Joseph Blubaugh. Last updated 2 years ago.
algotradingapirobinhoodrobinhood-apitrade
79.1 match 45 stars 4.58 score 17 scriptstychobra
polished:Authentication and Hosting for 'shiny' Apps
Authentication, user administration, hosting, and additional infrastructure for 'shiny' apps. See <https://polished.tech> for additional documentation and examples.
Maintained by Andy Merlino. Last updated 12 days ago.
43.9 match 233 stars 8.09 score 75 scriptslaresbernardo
lares:Analytics & Machine Learning Sidekick
Auxiliary package for better/faster analytics, visualization, data mining, and machine learning tasks. With a wide variety of family functions, like Machine Learning, Data Wrangling, Marketing Mix Modeling (Robyn), Exploratory, API, and Scrapper, it helps the analyst or data scientist to get quick and robust results, without the need of repetitive coding or advanced R programming skills.
Maintained by Bernardo Lares. Last updated 1 months ago.
analyticsapiautomationautomldata-sciencedescriptive-statisticsh2omachine-learningmarketingmmmpredictive-modelingpuzzlerlanguagerobynvisualization
33.8 match 233 stars 9.92 score 185 scripts 1 dependentszumbov2
deeplr:Interface to the 'DeepL' Translation API
A wrapper for the 'DeepL' Pro API <https://www.deepl.com/docs-api>, a web service for translating texts between different languages. A DeepL API developer account is required to use the service (see <https://www.deepl.com/pro#developer>).
Maintained by David Zumbach. Last updated 1 years ago.
60.0 match 41 stars 5.56 score 70 scriptsropensci
rcrossref:Client for Various 'CrossRef' 'APIs'
Client for various 'CrossRef' 'APIs', including 'metadata' search with their old and newer search 'APIs', get 'citations' in various formats (including 'bibtex', 'citeproc-json', 'rdf-xml', etc.), convert 'DOIs' to 'PMIDs', and 'vice versa', get citations for 'DOIs', and get links to full text of articles when available.
Maintained by Najko Jahn. Last updated 2 years ago.
text-mingliteraturepdfxmlpublicationscitationsfull-texttdmcrossrefapiapi-wrappercrossref-apidoimetadata
31.8 match 171 stars 10.15 score 404 scripts 10 dependentsusepa
ccdR:Utilities for Interacting with the 'CTX' APIs
Access chemical, hazard, bioactivity, and exposure data from the Computational Toxicology and Exposure ('CTX') APIs <https://api-ccte.epa.gov/docs/>. 'ccdR' was developed to streamline the process of accessing the information available through the 'CTX' APIs without requiring prior knowledge of how to use APIs. Most data is also available on the CompTox Chemical Dashboard ('CCD') <https://comptox.epa.gov/dashboard/> and other resources found at the EPA Computational Toxicology and Exposure Online Resources <https://www.epa.gov/comptox-tools>.
Maintained by Paul Kruse. Last updated 9 months ago.
50.6 match 2 stars 6.38 score 7 scriptsropensci
rredlist:'IUCN' Red List Client
'IUCN' Red List (<https://api.iucnredlist.org/>) client. The 'IUCN' Red List is a global list of threatened and endangered species. Functions cover all of the Red List 'API' routes. An 'API' key is required.
Maintained by William Gearty. Last updated 2 months ago.
iucnbiodiversityapiweb-servicestraitshabitatspeciesconservationapi-wrapperiucn-red-listtaxize
27.5 match 53 stars 11.49 score 195 scripts 24 dependentsropensci
comtradr:Interface with the United Nations Comtrade API
Interface with and extract data from the United Nations 'Comtrade' API <https://comtradeplus.un.org/>. 'Comtrade' provides country level shipping data for a variety of commodities, these functions allow for easy API query and data returned as a tidy data frame.
Maintained by Paul Bochtler. Last updated 5 months ago.
apicomtradepeer-reviewedsupply-chain
35.9 match 66 stars 8.67 score 70 scriptsr-lib
gargle:Utilities for Working with Google APIs
Provides utilities for working with Google APIs <https://developers.google.com/apis-explorer>. This includes functions and classes for handling common credential types and for preparing, executing, and processing HTTP requests.
Maintained by Jennifer Bryan. Last updated 2 years ago.
20.4 match 113 stars 14.90 score 266 scripts 192 dependentsbioc
sevenbridges:Seven Bridges Platform API Client and Common Workflow Language Tool Builder in R
R client and utilities for Seven Bridges platform API, from Cancer Genomics Cloud to other Seven Bridges supported platforms.
Maintained by Phil Webster. Last updated 5 months ago.
softwaredataimportthirdpartyclientapi-clientbioconductorbioinformaticscloudcommon-workflow-languagesevenbridges
40.6 match 35 stars 7.40 score 24 scriptsserkor1
cryptoQuotes:Open Access to Cryptocurrency Market Data, Sentiment Indicators and Interactive Charts
This high-level API client provides open access to cryptocurrency market data, sentiment indicators, and interactive charting tools. The data is sourced from major cryptocurrency exchanges via 'curl' and returned in 'xts'-format. The data comes in open, high, low, and close (OHLC) format with flexible granularity, ranging from seconds to months. This flexibility makes it ideal for developing and backtesting trading strategies or conducting detailed market analysis.
Maintained by Serkan Korkmaz. Last updated 5 months ago.
binancebinance-apibitmartbybitbybit-apicryptocurrenciescryptocurrencycryptocurrency-exchangeshuobihuobi-apikraken-apikraken-exchange-apikucoinkucoin-api
44.7 match 39 stars 6.66 score 26 scriptscloudyr
googleCloudStorageR:Interface with Google Cloud Storage API
Interact with Google Cloud Storage <https://cloud.google.com/storage/> API in R. Part of the 'cloudyr' <https://cloudyr.github.io/> project.
Maintained by Mark Edmondson. Last updated 19 days ago.
apiapi-clientgoogle-cloud-storagegoogleauthr
28.8 match 104 stars 10.28 score 548 scripts 1 dependentssboysel
fredr:An R Client for the 'FRED' API
An R client for the 'Federal Reserve Economic Data' ('FRED') API <https://research.stlouisfed.org/docs/api/>. Functions to retrieve economic time series and other data from 'FRED'.
Maintained by Sam Boysel. Last updated 4 years ago.
apiclientdataeconomicfederal-reservefredfred-apifred-seriesfredr
32.9 match 93 stars 8.95 score 700 scriptsropensci
gistr:Work with 'GitHub' 'Gists'
Work with 'GitHub' 'gists' from 'R' (e.g., <https://en.wikipedia.org/wiki/GitHub#Gist>, <https://docs.github.com/en/github/writing-on-github/creating-gists/>). A 'gist' is simply one or more files with code/text/images/etc. This package allows the user to create new 'gists', update 'gists' with new files, rename files, delete files, get and delete 'gists', star and 'un-star' 'gists', fork 'gists', open a 'gist' in your default browser, get embed code for a 'gist', list 'gist' 'commits', and get rate limit information when 'authenticated'. Some requests require authentication and some do not. 'Gists' website: <https://gist.github.com/>.
Maintained by Scott Chamberlain. Last updated 2 years ago.
httphttpsapiweb-servicesgithubgithub apigistgistscodescriptsnippetapi-wrappergithub-apigithub-gist
35.2 match 104 stars 8.28 score 42 scripts 2 dependentsr-lib
httr:Tools for Working with URLs and HTTP
Useful tools for working with HTTP organised by HTTP verbs (GET(), POST(), etc). Configuration functions make it easy to control additional request components (authenticate(), add_headers() and so on).
Maintained by Hadley Wickham. Last updated 1 years ago.
14.1 match 989 stars 20.56 score 29k scripts 4.3k dependentsdieghernan
nominatimlite:Interface with 'Nominatim' API Service
Lite interface for getting data from 'OSM' service 'Nominatim' <https://nominatim.org/release-docs/latest/>. Extract coordinates from addresses, find places near a set of coordinates and return spatial objects on 'sf' format.
Maintained by Diego Hernangómez. Last updated 13 days ago.
geocodingopenstreetmapaddressnominatimreverse-geocodingshapefilespatialapi-wrapperapigis
36.2 match 20 stars 8.01 score 41 scripts 1 dependentsropensci
elastic:General Purpose Interface to 'Elasticsearch'
Connect to 'Elasticsearch', a 'NoSQL' database built on the 'Java' Virtual Machine. Interacts with the 'Elasticsearch' 'HTTP' API (<https://www.elastic.co/elasticsearch/>), including functions for setting connection details to 'Elasticsearch' instances, loading bulk data, searching for documents with both 'HTTP' query variables and 'JSON' based body requests. In addition, 'elastic' provides functions for interacting with API's for 'indices', documents, nodes, clusters, an interface to the cat API, and more.
Maintained by Scott Chamberlain. Last updated 2 years ago.
databaseelasticsearchhttpapisearchnosqljavajsondocumentsdata-sciencedatabase-wrapperetl
32.1 match 247 stars 8.98 score 151 scripts 1 dependentssymbolixau
googleway:Accesses Google Maps APIs to Retrieve Data and Plot Maps
Provides a mechanism to plot a 'Google Map' from 'R' and overlay it with shapes and markers. Also provides access to 'Google Maps' APIs, including places, directions, roads, distances, geocoding, elevation and timezone.
Maintained by David Cooley. Last updated 7 months ago.
google-mapgoogle-mapsgoogle-maps-apigoogle-maps-javascript-apispatialspatial-analysis
28.5 match 236 stars 9.67 score 536 scripts 2 dependentsironholds
WikipediR:A MediaWiki API Wrapper
A wrapper for the MediaWiki API, aimed particularly at the Wikimedia 'production' wikis, such as Wikipedia. It can be used to retrieve page text, information about users or the history of pages, and elements of the category tree.
Maintained by Os Keyes. Last updated 12 months ago.
api-clientapi-wrappermediawiki
28.6 match 71 stars 9.65 score 81 scripts 35 dependentsropensci
ckanr:Client for the Comprehensive Knowledge Archive Network ('CKAN') API
Client for 'CKAN' API (<https://ckan.org/>). Includes interface to 'CKAN' 'APIs' for search, list, show for packages, organizations, and resources. In addition, provides an interface to the 'datastore' API.
Maintained by Francisco Alves. Last updated 2 years ago.
databaseopen-datackanapidatadatasetapi-wrapperckan-api
31.7 match 98 stars 8.60 score 448 scripts 4 dependentsr-lib
gh:'GitHub' 'API'
Minimal client to access the 'GitHub' 'API'.
Maintained by Gábor Csárdi. Last updated 2 months ago.
17.4 match 224 stars 15.55 score 444 scripts 401 dependents8-bit-sheep
googleAnalyticsR:Google Analytics API into R
Interact with the Google Analytics APIs <https://developers.google.com/analytics/>, including the Core Reporting API (v3 and v4), Management API, User Activity API GA4's Data API and Admin API and Multi-Channel Funnel API.
Maintained by Erik Grönroos. Last updated 7 months ago.
analyticsapigooglegoogleanalyticsrgoogleauthr
26.4 match 262 stars 10.11 score 680 scripts 1 dependentsropensci
worrms:World Register of Marine Species (WoRMS) Client
Client for World Register of Marine Species (<https://www.marinespecies.org/>). Includes functions for each of the API methods, including searching for names by name, date and common names, searching using external identifiers, fetching synonyms, as well as fetching taxonomic children and taxonomic classification.
Maintained by Bart Vanhoorne.. Last updated 1 years ago.
biologysciencemarineapiwebapi-clientwormsspeciesapi-wrapperbiological-datafishjerico-relevantmarine-biologymarine-speciestaxizetaxonomy
26.5 match 27 stars 10.04 score 372 scripts 27 dependentsvusaverse
vvcanvas:'Canvas' LMS API Integration
Allow R users to interact with the 'Canvas' Learning Management System (LMS) API (see <https://canvas.instructure.com/doc/api/all_resources.html> for details). It provides a set of functions to access and manipulate course data, assignments, grades, users, and other resources available through the 'Canvas' API.
Maintained by Tomer Iwan. Last updated 17 hours ago.
canvascanvas-lmscanvas-lms-apicanvasapieducationalinstructure-canvas
41.8 match 8 stars 6.33 score 10 scriptsmichaeldorman
mapsapi:'sf'-Compatible Interface to 'Google Maps' APIs
Interface to the 'Google Maps' APIs: (1) routing directions based on the 'Directions' API, returned as 'sf' objects, either as single feature per alternative route, or a single feature per segment per alternative route; (2) travel distance or time matrices based on the 'Distance Matrix' API; (3) geocoded locations based on the 'Geocode' API, returned as 'sf' objects, either points or bounds; (4) map images using the 'Maps Static' API, returned as 'stars' objects.
Maintained by Michael Dorman. Last updated 2 years ago.
36.6 match 51 stars 7.10 score 99 scriptsquandl
Quandl:API Wrapper for Quandl.com
Functions for interacting directly with the Quandl API to offer data in a number of formats usable in R, downloading a zip with all data from a Quandl database, and the ability to search. This R package uses the Quandl API. For more information go to <https://docs.quandl.com>. For more help on the package itself go to <https://www.quandl.com/tools/r>.
Maintained by Dave Dotson. Last updated 3 years ago.
26.6 match 137 stars 9.74 score 980 scripts 3 dependentsselesnow
rym:R Interface to Yandex Metrica API
Allows work with 'Management API' for load counters, segments, filters, user permissions and goals list from Yandex Metrica, 'Reporting API' allows you to get information about the statistics of site visits and other data without using the web interface, 'Logs API' allows to receive non-aggregated data and 'Compatible with Google Analytics Core Reporting API v3' allows receive information about site traffic and other data using field names from Google Analytics Core API. For more information see official documents <https://yandex.ru/dev/metrika/doc/api2/concept/about-docpage>.
Maintained by Alexey Seleznev. Last updated 2 years ago.
37.7 match 13 stars 6.68 score 31 scripts 1 dependentsstatnet
ergm:Fit, Simulate and Diagnose Exponential-Family Models for Networks
An integrated set of tools to analyze and simulate networks based on exponential-family random graph models (ERGMs). 'ergm' is a part of the Statnet suite of packages for network analysis. See Hunter, Handcock, Butts, Goodreau, and Morris (2008) <doi:10.18637/jss.v024.i03> and Krivitsky, Hunter, Morris, and Klumb (2023) <doi:10.18637/jss.v105.i06>.
Maintained by Pavel N. Krivitsky. Last updated 22 days ago.
16.4 match 100 stars 15.36 score 1.4k scripts 36 dependentsrisktoollib
RTL:Risk Tool Library - Trading, Risk, Analytics for Commodities
A toolkit for Commodities 'analytics', risk management and trading professionals. Includes functions for API calls to <https://commodities.morningstar.com/#/>, <https://developer.genscape.com/>, and <https://www.bankofcanada.ca/valet/docs>.
Maintained by Philippe Cote. Last updated 1 months ago.
analyticsapicommoditiescommodities-apifinancegenscapemorningstarpythonrisk-managementcpp
33.4 match 30 stars 7.51 score 198 scriptscanmod
iidda.api:IIDDA API
R Bindings for the IIDDA API.
Maintained by Steve Walker. Last updated 4 months ago.
47.9 match 5.24 score 10 scriptscran
Rmpi:Interface (Wrapper) to MPI (Message-Passing Interface)
An interface (wrapper) to MPI. It also provides interactive R manager and worker environment.
Maintained by Hao Yu. Last updated 3 months ago.
51.8 match 5 stars 4.76 score 5 dependentstomeriko96
polyglotr:Translate Text
Provide easy methods to translate pieces of text. Functions send requests to translation services online.
Maintained by Tomer Iwan. Last updated 2 months ago.
google-translategoogletranslatelanguagelingueemymemory-apimymemorytranslatorponstranslationtranslations-api
32.2 match 33 stars 7.61 score 34 scripts 1 dependentsinrae
hubeau:Get Data from the French National Database on Water 'Hub'Eau'
Collection of functions to help retrieving data from 'Hub'Eau' the free and public French National APIs on water <https://hubeau.eaufrance.fr/>.
Maintained by David Dorchies. Last updated 3 months ago.
36.8 match 12 stars 6.49 score 19 scriptskeberwein
blscrapeR:An API Wrapper for the United States Bureau of Labor Statistics
Scrapes various data from <https://www.bls.gov/>. The Bureau of Labor Statistics is the statistical branch of the United States Department of Labor. The package has additional functions to help parse, analyze and visualize the data.
Maintained by Kris Eberwein. Last updated 1 years ago.
apiapi-wrapperblsbureau-of-labor-statisticsconsumer-price-indexcpiinflationinflation-calculatorlabor-statisticsunemployment
30.7 match 112 stars 7.66 score 270 scriptssbg
sevenbridges2:The 'Seven Bridges Platform' API Client
R client and utilities for 'Seven Bridges Platform' API, from 'Cancer Genomics Cloud' to other 'Seven Bridges' supported platforms. API documentation is hosted publicly at <https://docs.sevenbridges.com/docs/the-api>.
Maintained by Marko Trifunovic. Last updated 6 days ago.
api-clientbioinformaticscloudsevenbridges
36.9 match 3 stars 6.32 score 4 scriptsropensci
rgbif:Interface to the Global Biodiversity Information Facility API
A programmatic interface to the Web Service methods provided by the Global Biodiversity Information Facility (GBIF; <https://www.gbif.org/developer/summary>). GBIF is a database of species occurrence records from sources all over the globe. rgbif includes functions for searching for taxonomic names, retrieving information on data providers, getting species occurrence records, getting counts of occurrence records, and using the GBIF tile map service to make rasters summarizing huge amounts of data.
Maintained by John Waller. Last updated 18 days ago.
gbifspecimensapiweb-servicesoccurrencesspeciestaxonomybiodiversitydatalifewatchoscibiospocc
17.3 match 161 stars 13.26 score 2.1k scripts 20 dependentsmuschellij2
rscopus:Scopus Database 'API' Interface
Uses Elsevier 'Scopus' API <https://dev.elsevier.com/sc_apis.html> to download information about authors and their citations.
Maintained by John Muschelli. Last updated 4 days ago.
24.1 match 77 stars 9.40 score 124 scripts 3 dependentsropensci
weatherOz:An API Client for Australian Weather and Climate Data Resources
Provides automated downloading, parsing and formatting of weather data for Australia through API endpoints provided by the Department of Primary Industries and Regional Development ('DPIRD') of Western Australia and by the Science and Technology Division of the Queensland Government's Department of Environment and Science ('DES'). As well as the Bureau of Meteorology ('BOM') of the Australian government precis and coastal forecasts, and downloading and importing radar and satellite imagery files. 'DPIRD' weather data are accessed through public 'APIs' provided by 'DPIRD', <https://www.agric.wa.gov.au/weather-api-20>, providing access to weather station data from the 'DPIRD' weather station network. Australia-wide weather data are based on data from the Australian Bureau of Meteorology ('BOM') data and accessed through 'SILO' (Scientific Information for Land Owners) Jeffrey et al. (2001) <doi:10.1016/S1364-8152(01)00008-1>. 'DPIRD' data are made available under a Creative Commons Attribution 3.0 Licence (CC BY 3.0 AU) license <https://creativecommons.org/licenses/by/3.0/au/deed.en>. SILO data are released under a Creative Commons Attribution 4.0 International licence (CC BY 4.0) <https://creativecommons.org/licenses/by/4.0/>. 'BOM' data are (c) Australian Government Bureau of Meteorology and released under a Creative Commons (CC) Attribution 3.0 licence or Public Access Licence ('PAL') as appropriate, see <http://www.bom.gov.au/other/copyright.shtml> for further details.
Maintained by Rodrigo Pires. Last updated 1 months ago.
dpirdbommeteorological-dataweather-forecastaustraliaweatherweather-datameteorologywestern-australiaaustralia-bureau-of-meteorologywestern-australia-agricultureaustralia-agricultureaustralia-climateaustralia-weatherapi-clientclimatedatarainfallweather-api
26.3 match 31 stars 8.47 score 40 scriptsropensci
qualtRics:Download 'Qualtrics' Survey Data
Provides functions to access survey results directly into R using the 'Qualtrics' API. 'Qualtrics' <https://www.qualtrics.com/about/> is an online survey and data collection software platform. See <https://api.qualtrics.com/> for more information about the 'Qualtrics' API. This package is community-maintained and is not officially supported by 'Qualtrics'.
Maintained by Julia Silge. Last updated 7 months ago.
apiqualtricsqualtrics-apisurveysurvey-data
21.1 match 221 stars 10.23 score 272 scriptsvusaverse
vvtermtime:Interface for 'Semestry TermTime' Services
Provides an R interface for interacting with the 'Semestry TermTime' services. It allows users to retrieve scheduling data from the API. see <https://github.com/vusaverse/vvtermtime/blob/main/openapi_7.7.0.pdf> for details.
Maintained by Tomer Iwan. Last updated 11 months ago.
schedulingsemestrytermtimetimetables
57.6 match 3.70 score 5 scriptsropensci
rdatacite:Client for the 'DataCite' API
Client for the web service methods provided by 'DataCite' (<https://www.datacite.org/>), including functions to interface with their 'RESTful' search API. The API is backed by 'Elasticsearch', allowing expressive queries, including faceting.
Maintained by Bianca Kramer. Last updated 2 years ago.
datascholarlydatasethttpsapiweb-servicesapi-wrapperdataciteidentifiermetadataoai-pmhsolr
42.5 match 25 stars 4.99 score 26 scriptsropengov
giscoR:Download Map Data from GISCO API - Eurostat
Tools to download data from the GISCO (Geographic Information System of the Commission) Eurostat database <https://ec.europa.eu/eurostat/web/gisco>. Global and European map data available. This package is in no way officially related to or endorsed by Eurostat.
Maintained by Diego Hernangómez. Last updated 5 days ago.
ropengovspatialapi-wrappereurostatgiscothematic-mapseurostat-dataggplot2gis
19.7 match 75 stars 10.70 score 424 scripts 5 dependentsropenspain
climaemet:Climate AEMET Tools
Tools to download the climatic data of the Spanish Meteorological Agency (AEMET) directly from R using their API and create scientific graphs (climate charts, trend analysis of climate time series, temperature and precipitation anomalies maps, warming stripes graphics, climatograms, etc.).
Maintained by Diego Hernangómez. Last updated 7 days ago.
aemetclimatedataforecast-apiropenspainsciencespainweather-api
25.1 match 42 stars 8.25 score 59 scriptsropensci
ritis:Integrated Taxonomic Information System Client
An interface to the Integrated Taxonomic Information System ('ITIS') (<https://www.itis.gov>). Includes functions to work with the 'ITIS' REST API methods (<https://www.itis.gov/ws_description.html>), as well as the 'Solr' web service (<https://www.itis.gov/solr_documentation.html>).
Maintained by Julia Blum. Last updated 2 months ago.
taxonomybiologynomenclaturejsonapiwebapi-clientidentifiersspeciesnamesapi-wrapperitistaxize
26.5 match 16 stars 7.72 score 64 scripts 24 dependentsropensci
osmapiR:'OpenStreetMap' API
Interface to 'OpenStreetMap API' for fetching and saving data from/to the 'OpenStreetMap' database (<https://wiki.openstreetmap.org/wiki/API_v0.6>).
Maintained by Joan Maspons. Last updated 4 months ago.
open street mapopenstreetmaposmopenstreetmap-apiosmapiapi
27.0 match 22 stars 7.42 score 6 scriptsouhscbbmc
REDCapR:Interaction Between R and REDCap
Encapsulates functions to streamline calls from R to the REDCap API. REDCap (Research Electronic Data CAPture) is a web application for building and managing online surveys and databases developed at Vanderbilt University. The Application Programming Interface (API) offers an avenue to access and modify data programmatically, improving the capacity for literate and reproducible programming.
Maintained by Will Beasley. Last updated 3 months ago.
16.2 match 118 stars 12.36 score 438 scripts 6 dependentsropensci
crul:HTTP Client
A simple HTTP client, with tools for making HTTP requests, and mocking HTTP requests. The package is built on R6, and takes inspiration from Ruby's 'faraday' gem (<https://rubygems.org/gems/faraday>). The package name is a play on curl, the widely used command line tool for HTTP, and this package is built on top of the R package 'curl', an interface to 'libcurl' (<https://curl.se/libcurl/>).
Maintained by Scott Chamberlain. Last updated 8 months ago.
httphttpsapiweb-servicescurldownloadlibcurlasyncmockingcaching
14.1 match 107 stars 14.07 score 240 scripts 168 dependentsipums
ipumsr:An R Interface for Downloading, Reading, and Handling IPUMS Data
An easy way to work with census, survey, and geographic data provided by IPUMS in R. Generate and download data through the IPUMS API and load IPUMS files into R with their associated metadata to make analysis easier. IPUMS data describing 1.4 billion individuals drawn from over 750 censuses and surveys is available free of charge from the IPUMS website <https://www.ipums.org>.
Maintained by Derek Burk. Last updated 1 months ago.
17.8 match 30 stars 11.05 score 720 scripts 2 dependentsdieghernan
arcgeocoder:Geocoding with the 'ArcGIS' REST API Service
Lite interface for finding locations of addresses or businesses around the world using the 'ArcGIS' REST API service <https://developers.arcgis.com/rest/geocode/api-reference/overview-world-geocoding-service.htm>. Address text can be converted to location candidates and a location can be converted into an address. No API key required.
Maintained by Diego Hernangómez. Last updated 6 days ago.
geocodingarcgisaddressreverse-geocodingapi-wrapperapi-restarcgis-apigis
35.2 match 2 stars 5.59 score 15 scriptsropensci
rsnps:Get 'SNP' ('Single-Nucleotide' 'Polymorphism') Data on the Web
A programmatic interface to various 'SNP' 'datasets' on the web: 'OpenSNP' (<https://opensnp.org>), and 'NBCIs' 'dbSNP' database (<https://www.ncbi.nlm.nih.gov/projects/SNP/>). Functions are included for searching for 'NCBI'. For 'OpenSNP', functions are included for getting 'SNPs', and data for 'genotypes', 'phenotypes', annotations, and bulk downloads of data by user.
Maintained by Julia Gustavsen. Last updated 2 years ago.
genesnpsequenceapiwebapi-clientspeciesdbsnpopensnpncbigenotypedatasnpsweb-api
27.7 match 53 stars 7.08 score 63 scripts 1 dependentshauselin
ollamar:'Ollama' Language Models
An interface to easily run local language models with 'Ollama' <https://ollama.com> server and API endpoints (see <https://github.com/ollama/ollama/blob/main/docs/api.md> for details). It lets you run open-source large language models locally on your machine.
Maintained by Hause Lin. Last updated 7 days ago.
21.0 match 89 stars 9.32 score 74 scripts 5 dependentsbioc
xcms:LC-MS and GC-MS Data Analysis
Framework for processing and visualization of chromatographically separated and single-spectra mass spectral data. Imports from AIA/ANDI NetCDF, mzXML, mzData and mzML files. Preprocesses data for high-throughput, untargeted analyte profiling.
Maintained by Steffen Neumann. Last updated 18 days ago.
immunooncologymassspectrometrymetabolomicsbioconductorfeature-detectionmass-spectrometrypeak-detectioncpp
13.6 match 196 stars 14.31 score 984 scripts 11 dependentspedropark99
figma:Web Client/Wrapper to the 'Figma API'
An easy-to-use web client/wrapper for the 'Figma API' <https://www.figma.com/developers/api>. It allows you to bring all data from a 'Figma' file to your 'R' session. This includes the data of all objects that you have drawn in this file, and their respective canvas/page metadata.
Maintained by Pedro Faria. Last updated 2 years ago.
36.5 match 4 stars 5.30 score 33 scriptsjameshwade
gpttools:Extensions and Tools for gptstudio
gpttools is an R package that provides extensions to gptstudio to provide devtools-like functionality using the latest natural language processing (NLP) models. It is designed to make package development easier by providing a range of tools and functions that can be used to improve the quality of your package's documentation, testing, and maybe even functionality.
Maintained by James Wade. Last updated 7 months ago.
chatgptnlpopenaipackage-developmentrstudio-addin
28.3 match 296 stars 6.76 score 14 scriptsrstudio
vetiver:Version, Share, Deploy, and Monitor Models
The goal of 'vetiver' is to provide fluent tooling to version, share, deploy, and monitor a trained model. Functions handle both recording and checking the model's input data prototype, and predicting from a remote API endpoint. The 'vetiver' package is extensible, with generics that can support many kinds of models.
Maintained by Julia Silge. Last updated 6 months ago.
17.7 match 185 stars 10.48 score 466 scripts 1 dependentsropensci
wikitaxa:Taxonomic Information from 'Wikipedia'
'Taxonomic' information from 'Wikipedia', 'Wikicommons', 'Wikispecies', and 'Wikidata'. Functions included for getting taxonomic information from each of the sources just listed, as well performing taxonomic search.
Maintained by Zachary Foster. Last updated 6 months ago.
taxonomyspeciesapiweb-serviceswikipediavernacularwikispecieswikicommonstaxizewikipedia-api
23.0 match 21 stars 8.05 score 11 scripts 24 dependentsstevenmmortimer
rdfp:An Implementation of the 'DoubleClick for Publishers' API
Functions to interact with the 'Google DoubleClick for Publishers (DFP)' API <https://developers.google.com/ad-manager/api/start> (recently renamed to 'Google Ad Manager'). This package is automatically compiled from the API WSDL (Web Service Description Language) files to dictate how the API is structured. Theoretically, all API actions are possible using this package; however, care must be taken to format the inputs correctly and parse the outputs correctly. Please see the 'Google Ad Manager' API reference <https://developers.google.com/ad-manager/api/rel_notes> and this package's website <https://stevenmmortimer.github.io/rdfp/> for more information, documentation, and examples.
Maintained by Steven M. Mortimer. Last updated 6 years ago.
api-clientapi-wrapperdfpdfp-apidoubleclickdoubleclick-for-publishersgoogle-dfp
26.7 match 16 stars 6.93 score 214 scriptsropensci
eia:API Wrapper for U.S. Energy Information Administration ('EIA') Open Data
Provides API access to data from the U.S. Energy Information Administration ('EIA') <https://www.eia.gov/>. Use of the EIA's API and this package requires a free API key obtainable at <https://www.eia.gov/opendata/register.php>. This package includes functions for searching the EIA data directory and returning time series and geoset time series datasets. Datasets returned by these functions are provided by default in a tidy format, or alternatively, in more raw formats. It also offers helper functions for working with EIA date strings and time formats and for inspecting different summaries of series metadata. The package also provides control over API key storage and caching of API request results.
Maintained by Matthew Hoff. Last updated 9 months ago.
eiaeia-apienergy-dataenergy-information-administrationopen-data
25.2 match 47 stars 7.30 score 35 scriptssimon-lenau
prolific.api:A User-Friendly Interface for Accessing the Prolific API
A user-friendly interface for creating and managing empirical crowd-sourcing studies via API access to <https://www.prolific.co>.
Maintained by Simon Lenau. Last updated 2 years ago.
crowd-sourcingcrowdsourcing-experimentscrowdsourcing-platformsempirical-researchparticipantssampling
49.5 match 3.70 score 8 scriptsropensci
epair:EPA Data Helper for R
Aid the user in making queries to the EPA API site found at https://aqs.epa.gov/aqsweb/documents/data_api. This package combines API calling methods from various web scraping packages with specific strings to retrieve data from the EPA API. It also contains easy to use loaded variables that help a user navigate services offered by the API and aid the user in determining the appropriate way to make a an API call.
Maintained by G.L. Orozco-Mulfinger. Last updated 3 years ago.
37.2 match 7 stars 4.89 score 11 scriptsdickoa
robotoolbox:Client for the 'KoboToolbox' API
Suite of utilities for accessing and manipulating data from the 'KoboToolbox' API. 'KoboToolbox' is a robust platform designed for field data collection in various disciplines. This package aims to simplify the process of fetching and handling data from the API. Detailed documentation for the 'KoboToolbox' API can be found at <https://support.kobotoolbox.org/api.html>.
Maintained by Ahmadou Dicko. Last updated 3 months ago.
open-datakobotoolboxodkkpiapidatadataset
30.7 match 5.86 score 48 scriptshrecht
censusapi:Retrieve Data from the Census APIs
A wrapper for the U.S. Census Bureau APIs that returns data frames of Census data and metadata. Available datasets include the Decennial Census, American Community Survey, Small Area Health Insurance Estimates, Small Area Income and Poverty Estimates, Population Estimates and Projections, and more.
Maintained by Hannah Recht. Last updated 26 days ago.
censuscensus-apicensus-datademographicsopen-data
18.2 match 174 stars 9.76 score 708 scripts 6 dependentsrte-antares-rpackage
antaresEditObject:Edit an 'Antares' Simulation
Edit an 'Antares' simulation before running it : create new areas, links, thermal clusters or binding constraints or edit existing ones. Update 'Antares' general & optimization settings. 'Antares' is an open source power system generator, more information available here : <https://antares-simulator.org/>.
Maintained by Tatiana Vargas. Last updated 1 months ago.
antares-simulationclusterenergymonte-carlo-simulationrte
20.3 match 8 stars 8.66 score 101 scriptsmountainmath
cancensus:Access, Retrieve, and Work with Canadian Census Data and Geography
Integrated, convenient, and uniform access to Canadian Census data and geography retrieved using the 'CensusMapper' API. This package produces analysis-ready tidy data frames and spatial data in multiple formats, as well as convenience functions for working with Census variables, variable hierarchies, and region selection. API keys are freely available with free registration at <https://censusmapper.ca/api>. Census data and boundary geometries are reproduced and distributed on an "as is" basis with the permission of Statistics Canada (Statistics Canada 2001; 2006; 2011; 2016; 2021).
Maintained by Dmitry Shkolnik. Last updated 1 years ago.
19.7 match 82 stars 8.80 score 414 scriptsazure
AzureGraph:Simple Interface to 'Microsoft Graph'
A simple interface to the 'Microsoft Graph' API <https://learn.microsoft.com/en-us/graph/overview>. 'Graph' is a comprehensive framework for accessing data in various online Microsoft services. This package was originally intended to provide an R interface only to the 'Azure Active Directory' part, with a view to supporting interoperability of R and 'Azure': users, groups, registered apps and service principals. However it has since been expanded into a more general tool for interacting with Graph. Part of the 'AzureR' family of packages.
Maintained by Hong Ooi. Last updated 2 years ago.
azure-active-directory-graph-apiazure-sdk-rmicrosoft-graph-api
16.8 match 32 stars 10.30 score 36 scripts 21 dependentsmrcieu
ieugwasr:Interface to the 'OpenGWAS' Database API
Interface to the 'OpenGWAS' database API <https://api.opengwas.io/api/>. Includes a wrapper to make generic calls to the API, plus convenience functions for specific queries.
Maintained by Gibran Hemani. Last updated 18 days ago.
16.0 match 89 stars 10.71 score 404 scripts 6 dependentsrucknium
rbch:Extraction and Analysis of Data from the Bitcoin Cash (BCH) Blockchain
Issues RPC-JSON calls to 'bitcoind', the daemon of Bitcoin Cash (BCH), to extract transaction data from the blockchain. BCH is a fork of Bitcoin that permits a greater number of transactions per second. A BCH daemon is available under an MIT license from the Bitcoin Unlimited website <https://www.bitcoinunlimited.info>.
Maintained by Rucknium. Last updated 5 months ago.
67.5 match 3 stars 2.48 score 7 scriptsropensci
ruODK:An R Client for the ODK Central API
Access and tidy up data from the 'ODK Central' API. 'ODK Central' is a clearinghouse for digitally captured data using ODK <https://docs.getodk.org/central-intro/>. It manages user accounts and permissions, stores form definitions, and allows data collection clients like 'ODK Collect' to connect to it for form download and submission upload. The 'ODK Central' API is documented at <https://docs.getodk.org/central-api/>.
Maintained by Florian W. Mayer. Last updated 5 months ago.
databaseopen-dataodkapidatadatasetodataodata-clientodk-centralopendatakit
21.6 match 42 stars 7.73 score 57 scripts 1 dependentschris-dworschak
disastr.api:Wrapper for the UN OCHA ReliefWeb Disaster Events API
Access and manage the application programming interface (API) of the United Nations Office for the Coordination of Humanitarian Affairs' (OCHA) ReliefWeb disaster events at <https://reliefweb.int/disasters>. The package requires a minimal number of dependencies. It offers functionality to retrieve a user-defined sample of disaster events from ReliefWeb, providing an easy alternative to scraping the ReliefWeb website. It enables a seamless integration of regular data updates into the research work flow.
Maintained by Christoph Dworschak. Last updated 11 months ago.
api-wrapperdisaster-eventsochareliefweb
52.3 match 3 stars 3.18 score 6 scriptsrladies
meetupr:Meetup R API
Provides access to data from <https:www.meetup.com> (see <https:www.meetup.com/meetup_api/> for more information).
Maintained by Athanasia Mo Mowinckel. Last updated 2 years ago.
apiapi-wrappermeetupr-ladiesrladiesrladies-global
23.3 match 77 stars 7.03 score 92 scriptsselesnow
rfacebookstat:Load Data from Facebook API Marketing
Load data by campaigns, ads, ad sets and insights, ad account and business manager from Facebook Marketing API into R. For more details see official documents by Facebook Marketing API <https://developers.facebook.com/docs/marketing-apis/>.
Maintained by Alexey Seleznev. Last updated 1 months ago.
22.0 match 31 stars 7.43 score 48 scripts 1 dependentsropensci
osmdata:Import 'OpenStreetMap' Data as Simple Features or Spatial Objects
Download and import of 'OpenStreetMap' ('OSM') data as 'sf' or 'sp' objects. 'OSM' data are extracted from the 'Overpass' web server (<https://overpass-api.de/>) and processed with very fast 'C++' routines for return to 'R'.
Maintained by Mark Padgham. Last updated 2 months ago.
open0street0mapopenstreetmapoverpass0apiosmcpposm-dataoverpass-apipeer-reviewedcpp
11.2 match 322 stars 14.53 score 2.8k scripts 14 dependentsropensci
traits:Species Trait Data from Around the Web
Species trait data from many different sources, including sequence data from 'NCBI' (<https://www.ncbi.nlm.nih.gov/>), plant trait data from 'BETYdb', data from 'EOL' 'Traitbank', 'Birdlife' International, and more.
Maintained by David LeBauer. Last updated 2 months ago.
traitsapiweb-servicesspeciestaxonomyapi-client
18.5 match 41 stars 8.65 score 82 scripts 11 dependentsropengov
pxweb:R Interface to PXWEB APIs
Generic interface for the PX-Web/PC-Axis API. The PX-Web/PC-Axis API is used by organizations such as Statistics Sweden and Statistics Finland to disseminate data. The R package can interact with all PX-Web/PC-Axis APIs to fetch information about the data hierarchy, extract metadata and extract and parse statistics to R data.frame format. PX-Web is a solution to disseminate PC-Axis data files in dynamic tables on the web. Since 2013 PX-Web contains an API to disseminate PC-Axis files.
Maintained by Mans Magnusson. Last updated 1 years ago.
21.1 match 66 stars 7.57 score 2 dependentsgiscience
openrouteservice:An 'openrouteservice' API Client
The client streamlines access to the services provided by <https://api.openrouteservice.org>. It allows you to painlessly query for directions, isochrones, time-distance matrices, geocoding, elevation, points of interest, and more.
Maintained by Andrzej K. Oleś. Last updated 2 months ago.
apidirectionsgisgiscienceisochronesopenrouteserviceopenstreetmappoisroutingsdk
20.0 match 108 stars 7.89 score 60 scriptschris-dworschak
acled.api:Automated Retrieval of ACLED Conflict Event Data
Access and manage the application programming interface (API) of the Armed Conflict Location & Event Data Project (ACLED) at <https://acleddata.com/>. The package makes it easy to retrieve a user-defined sample (or all of the available data) of ACLED, enabling a seamless integration of regular data updates into the research work flow. It requires a minimal number of dependencies. See the package's README file for a note on replicability when drawing on ACLED data. When using this package, you acknowledge that you have read ACLED's terms and conditions of use, and that you agree with their attribution requirements.
Maintained by Christoph Dworschak. Last updated 6 months ago.
44.1 match 3.56 score 24 scriptseblondel
zen4R:Interface to 'Zenodo' REST API
Provides an Interface to 'Zenodo' (<https://zenodo.org>) REST API, including management of depositions, attribution of DOIs by 'Zenodo' and upload and download of files.
Maintained by Emmanuel Blondel. Last updated 1 months ago.
apidatacitedepositionsdepositsdoifairzenodo
18.9 match 45 stars 8.25 score 76 scripts 1 dependentsidigbio
ridigbio:Interface to the iDigBio Data API
An interface to iDigBio's search API that allows downloading specimen records. Searches are returned as a data.frame. Other functions such as the metadata end points return lists of information. iDigBio is a US project focused on digitizing and serving museum specimen collections on the web. See <https://www.idigbio.org> for information on iDigBio.
Maintained by Jesse Bennett. Last updated 20 days ago.
15.1 match 16 stars 10.23 score 63 scripts 7 dependentsrstudio
keras3:R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks API. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both CPU and GPU devices.
Maintained by Tomasz Kalinowski. Last updated 11 days ago.
11.1 match 845 stars 13.63 score 264 scripts 2 dependentsnixtla
nixtlar:A Software Development Kit for 'Nixtla''s 'TimeGPT'
A Software Development Kit for working with 'Nixtla''s 'TimeGPT', a foundation model for time series forecasting. 'API' is an acronym for 'application programming interface'; this package allows users to interact with 'TimeGPT' via the 'API'. You can set and validate 'API' keys and generate forecasts via 'API' calls. It is compatible with 'tsibble' and base R. For more details visit <https://docs.nixtla.io/>.
Maintained by Mariana Menchero. Last updated 1 months ago.
18.5 match 32 stars 8.19 score 38 scriptsropensci
ghql:General Purpose 'GraphQL' Client
A 'GraphQL' client, with an R6 interface for initializing a connection to a 'GraphQL' instance, and methods for constructing queries, including fragments and parameterized queries. Queries are checked with the 'libgraphqlparser' C++ parser via the 'graphql' package.
Maintained by Mark Padgham. Last updated 2 years ago.
httpapiweb-servicescurldatagraphqlgraphql-apigraphql-client
18.5 match 148 stars 8.12 score 111 scripts 5 dependentscivisanalytics
civis:R Client for the 'Civis Platform API'
A convenient interface for making requests directly to the 'Civis Platform API' <https://www.civisanalytics.com/platform/>. Full documentation available 'here' <https://civisanalytics.github.io/civis-r/>.
Maintained by Peter Cooman. Last updated 2 months ago.
19.0 match 16 stars 7.84 score 144 scriptsropensci
nasapower:NASA POWER API Client
An API client for NASA POWER global meteorology, surface solar energy and climatology data API. POWER (Prediction Of Worldwide Energy Resources) data are freely available for download with varying spatial resolutions dependent on the original data and with several temporal resolutions depending on the POWER parameter and community. This work is funded through the NASA Earth Science Directorate Applied Science Program. For more on the data themselves, the methodologies used in creating, a web- based data viewer and web access, please see <https://power.larc.nasa.gov/>.
Maintained by Adam H. Sparks. Last updated 26 days ago.
nasameteorological-dataweatherglobalweather-datameteorologynasa-poweragroclimatologyearth-sciencedata-accessclimate-dataagroclimatology-dataweather-variables
14.8 match 101 stars 9.98 score 137 scripts 3 dependentsmrkaye97
slackr:Send Messages, Images, R Objects and Files to 'Slack' Channels/Users
'Slack' <https://slack.com/> provides a service for teams to collaborate by sharing messages, images, links, files and more. Functions are provided that make it possible to interact with the 'Slack' platform 'API'. When you need to share information or data from R, rather than resort to copy/ paste in e-mails or other services like 'Skype' <https://www.skype.com/en/>, you can use this package to send well-formatted output from multiple R objects and expressions to all teammates at the same time with little effort. You can also send images from the current graphics device, R objects, and upload files.
Maintained by Matt Kaye. Last updated 6 months ago.
12.7 match 306 stars 11.66 score 179 scriptsjulienrocheigepp
APIS:Auto-Adaptive Parentage Inference Software Tolerant to Missing Parents
Parentage assignment package. Parentage assignment is performed based on observed average Mendelian transmission probability distributions or Exclusion. The main functions of this package are the function APIS_2n(), APIS_3n() and launch_APIShiny(), which perform parentage assignment.
Maintained by Julien Roche. Last updated 5 months ago.
56.3 match 2.60 scorebioc
cBioPortalData:Exposes and Makes Available Data from the cBioPortal Web Resources
The cBioPortalData R package accesses study datasets from the cBio Cancer Genomics Portal. It accesses the data either from the pre-packaged zip / tar files or from the API interface that was recently implemented by the cBioPortal Data Team. The package can provide data in either tabular format or with MultiAssayExperiment object that uses familiar Bioconductor data representations.
Maintained by Marcel Ramos. Last updated 10 days ago.
softwareinfrastructurethirdpartyclientbioconductor-packagenci-itcru24ca289073
14.4 match 33 stars 10.17 score 147 scripts 4 dependentscloudyr
googleCloudVisionR:Access to the 'Google Cloud Vision' API for Image Recognition, OCR and Labeling
Interact with the 'Google Cloud Vision' <https://cloud.google.com/vision/> API in R. Part of the 'cloudyr' <https://cloudyr.github.io/> project.
Maintained by Jeno Pal. Last updated 5 years ago.
29.4 match 7 stars 4.95 score 14 scripts 1 dependentshrbrmstr
darksky:Tools to Work with the 'Dark Sky' 'API'
Provides programmatic access to the 'Dark Sky' 'API' <https://darksky.net/dev/docs>, which provides current or historical global weather conditions.
Maintained by Bob Rudis. Last updated 4 years ago.
darkskydarksky-apidarksky-api-powereddarksky-weather-apidarkskyapiweatherkit
26.2 match 83 stars 5.49 score 37 scriptsaleksanderbl29
dawaR:An API Wrapper for 'DAWA' - 'The Danish Address Web API'
Functions for interacting with all sections of the official 'Danish Address Web API' (also known as 'DAWA') <https://api.dataforsyningen.dk>. The development of this package is completely independent from the government agency, Klimadatastyrelsen, who maintains the API.
Maintained by Aleksander Bang-Larsen. Last updated 17 hours ago.
21.7 match 3 stars 6.51 score 9 scripts 1 dependentsdaroczig
binancer:API Client to 'Binance'
R client to the 'Binance' Public Rest API for data collection on cryptocurrencies, portfolio management and trading: <https://github.com/binance/binance-spot-api-docs/blob/master/rest-api.md>.
Maintained by Gergely Daróczi. Last updated 1 years ago.
apibinancebinance-apibitcoinblockchaincryptocurrency
27.6 match 53 stars 5.11 score 49 scriptsffverse
ffscrapr:API Client for Fantasy Football League Platforms
Helps access various Fantasy Football APIs by handling authentication and rate-limiting, forming appropriate calls, and returning tidy dataframes which can be easily connected to other data sources.
Maintained by Tan Ho. Last updated 5 months ago.
api-clientfantasy-footballfantasy-football-api
17.6 match 84 stars 7.94 score 178 scripts 1 dependentsposit-dev
connectapi:Utilities for Interacting with the 'Posit Connect' Server API
Provides a helpful 'R6' class and methods for interacting with the 'Posit Connect' Server API along with some meaningful utility functions for regular tasks. API documentation varies by 'Posit Connect' installation and version, but the latest documentation is also hosted publicly at <https://docs.posit.co/connect/api/>.
Maintained by Toph Allen. Last updated 9 hours ago.
13.2 match 47 stars 10.48 score 252 scripts 1 dependentsgojiplus
tuber:Client for the YouTube API
Get comments posted on YouTube videos, information on how many times a video has been liked, search for videos with particular content, and much more. You can also scrape captions from a few videos. To learn more about the YouTube API, see <https://developers.google.com/youtube/v3/>.
Maintained by Gaurav Sood. Last updated 7 days ago.
access-youtubecaptionvideoyoutubeyoutube-apiyoutube-oauth
15.0 match 184 stars 9.21 score 206 scriptscjbarrie
academictwitteR:Access the Twitter Academic Research Product Track V2 API Endpoint
Package to query the Twitter Academic Research Product Track, providing access to full-archive search and other v2 API endpoints. Functions are written with academic research in mind. They provide flexibility in how the user wishes to store collected data, and encourage regular storage of data to mitigate loss when collecting large volumes of tweets. They also provide workarounds to manage and reshape the format in which data is provided on the client side.
Maintained by Christopher Barrie. Last updated 2 years ago.
15.4 match 275 stars 8.94 score 177 scriptshakaiinstitute
hakaiApi:Authenticated HTTP Request Client for the 'Hakai' API
Initializes a class that obtains API credentials and provides a method to use those credentials to make GET requests to the 'Hakai' API server. Usage instructions are documented at <https://hakaiinstitute.github.io/hakai-api/>.
Maintained by Taylor Denouden. Last updated 5 months ago.
25.6 match 5 stars 5.34 score 11 scriptstidyverse
googlesheets4:Access Google Sheets using the Sheets API V4
Interact with Google Sheets through the Sheets API v4 <https://developers.google.com/sheets/api>. "API" is an acronym for "application programming interface"; the Sheets API allows users to interact with Google Sheets programmatically, instead of via a web browser. The "v4" refers to the fact that the Sheets API is currently at version 4. This package can read and write both the metadata and the cell data in a Sheet.
Maintained by Jennifer Bryan. Last updated 8 months ago.
google-drivegoogle-sheetsspreadsheet
9.3 match 363 stars 14.55 score 7.0k scripts 142 dependentsm-muecke
worldbank:Client for World Banks's 'Indicators' and 'Poverty and Inequality Platform (PIP)' APIs
Download and search data from the 'World Bank Indicators API', which provides access to nearly 16,000 time series indicators. See <https://datahelpdesk.worldbank.org/knowledgebase/articles/889392-about-the-indicators-api-documentation> for further details about the API.
Maintained by Maximilian Mücke. Last updated 14 days ago.
apiindicatorspovertyworldbankworldbank-api
27.8 match 5 stars 4.88 score 6 scriptsplotly
plotly:Create Interactive Web Graphics via 'plotly.js'
Create interactive web graphics from 'ggplot2' graphs and/or a custom interface to the (MIT-licensed) JavaScript library 'plotly.js' inspired by the grammar of graphics.
Maintained by Carson Sievert. Last updated 4 months ago.
d3jsdata-visualizationggplot2javascriptplotlyshinywebgl
6.9 match 2.6k stars 19.43 score 93k scripts 797 dependentsdewittpe
REDCapExporter:Automated Construction of R Data Packages from REDCap Projects
Export all data, including metadata, from a REDCap (Research Electronic Data Capture) Project via the REDCap API <https://projectredcap.org/wp-content/resources/REDCapTechnicalOverview.pdf>. The exported (meta)data will be processed and formatted into a stand alone R data package which can be installed and shared between researchers. Several default reports are generated as vignettes in the resulting package.
Maintained by Peter DeWitt. Last updated 5 months ago.
apidata-exportredcapredcap-api
25.1 match 2 stars 5.28 score 21 scriptsluomus
finbif:Interface for the 'Finnish Biodiversity Information Facility' API
A programmatic interface to the 'Finnish Biodiversity Information Facility' ('FinBIF') API (<https://api.laji.fi>). 'FinBIF' aggregates Finnish biodiversity data from multiple sources in a single open access portal for researchers, citizen scientists, industry and government. 'FinBIF' allows users of biodiversity information to find, access, combine and visualise data on Finnish plants, animals and microorganisms. The 'finbif' package makes the publicly available data in 'FinBIF' easily accessible to programmers. Biodiversity information is available on taxonomy and taxon occurrence. Occurrence data can be filtered by taxon, time, location and other variables. The data accessed are conveniently preformatted for subsequent analyses.
Maintained by William K. Morris. Last updated 12 days ago.
apibiodiversitybiodiversity-informaticsbiodiversity-informationfinbiffinbif-accessoccurrencesr-programmingspeciesspecimenstaxontaxonomyweb-services
16.4 match 5 stars 8.07 score 42 scripts 3 dependentsnceas
rt:Interface to the 'Request Tracker' API
Provides a programmatic interface to the 'Request Tracker' (RT) HTTP API <https://rt-wiki.bestpractical.com/wiki/REST>. 'RT' is a popular ticket tracking system.
Maintained by Bryce Mecum. Last updated 4 years ago.
16.5 match 6 stars 7.98 score 664 scriptsjessecambon
tidygeocoder:Geocoding Made Easy
An intuitive interface for getting data from geocoding services.
Maintained by Jesse Cambon. Last updated 4 hours ago.
11.1 match 288 stars 11.67 score 1.0k scripts 10 dependentsjimmyday12
fitzRoy:Easily Scrape and Process AFL Data
An easy package for scraping and processing Australia Rules Football (AFL) data. 'fitzRoy' provides a range of functions for accessing publicly available data from 'AFL Tables' <https://afltables.com/afl/afl_index.html>, 'Footy Wire' <https://www.footywire.com> and 'The Squiggle' <https://squiggle.com.au>. Further functions allow for easy processing, cleaning and transformation of this data into formats that can be used for analysis.
Maintained by James Day. Last updated 11 days ago.
12.1 match 136 stars 10.72 score 324 scriptscloudyr
googleComputeEngineR:R Interface with Google Compute Engine
Interact with the 'Google Compute Engine' API in R. Lets you create, start and stop instances in the 'Google Cloud'. Support for preconfigured instances, with templates for common R needs.
Maintained by Mark Edmondson. Last updated 16 days ago.
apicloud-computingcloudyrgoogle-cloudgoogleauthrlaunching-virtual-machines
13.3 match 152 stars 9.73 score 235 scriptspaws-r
paws:Amazon Web Services Software Development Kit
Interface to Amazon Web Services <https://aws.amazon.com>, including storage, database, and compute services, such as 'Simple Storage Service' ('S3'), 'DynamoDB' 'NoSQL' database, and 'Lambda' functions-as-a-service.
Maintained by Dyfan Jones. Last updated 19 days ago.
11.4 match 332 stars 11.25 score 177 scripts 12 dependentsrsquaredacademy
yahoofinancer:Fetch Data from Yahoo Finance API
Obtain historical and near real time data related to stocks, index and currencies from the Yahoo Finance API. This package is community maintained and is not officially supported by 'Yahoo'. The accuracy of data is only as correct as provided on <https://finance.yahoo.com/>.
Maintained by Aravind Hebbali. Last updated 2 months ago.
apiapi-wrapperfinancemarket-datastock-marketyahoo-financeyahoo-finance-api
28.7 match 16 stars 4.46 score 18 scriptssckott
request:High Level 'HTTP' Client
High level and easy 'HTTP' client for 'R' that makes assumptions that should work in most cases. Provides functions for building 'HTTP' queries, including query parameters, body requests, headers, authentication, and more.
Maintained by Scott Chamberlain. Last updated 5 years ago.
20.4 match 36 stars 6.16 score 812 scriptsrpradosiqueira
sidrar:An Interface to IBGE's SIDRA API
Allows the user to connect with IBGE's (Instituto Brasileiro de Geografia e Estatistica, see <https://www.ibge.gov.br/> for more information) SIDRA API in a flexible way. SIDRA is the acronym to "Sistema IBGE de Recuperacao Automatica" and is the system where IBGE turns available aggregate data from their researches.
Maintained by Renato Prado Siqueira. Last updated 3 years ago.
15.9 match 86 stars 7.85 score 226 scripts 1 dependentsflavioleccese92
Rduinoiot:'Arduino Iot Cloud API' R Client
Easily interact with the 'Arduino Iot Cloud API' <https://www.arduino.cc/reference/en/iot/api/>, managing devices, things, properties and data.
Maintained by Flavio Leccese. Last updated 1 years ago.
apiarduino-iot-cloudreal-timesensor
33.4 match 1 stars 3.70 score 3 scriptsthinkr-open
gitlabr:Access to the 'GitLab' API
Provides R functions to access the API of the project and repository management web application 'GitLab'. For many common tasks (repository file access, issue assignment and status, commenting) convenience wrappers are provided, and in addition the full API can be used by specifying request locations. 'GitLab' is open-source software and can be self-hosted or used on <https://about.gitlab.com>.
Maintained by Sébastien Rochette. Last updated 11 months ago.
14.6 match 40 stars 8.40 score 69 scripts 1 dependentsbergant
rapiclient:Dynamic OpenAPI/Swagger Client
Access services specified in OpenAPI (formerly Swagger) format. It is not a code generator. Client is generated dynamically as a list of R functions.
Maintained by Marcel Ramos. Last updated 6 months ago.
15.1 match 68 stars 8.07 score 32 scripts 13 dependentsbusiness-science
tidyquant:Tidy Quantitative Financial Analysis
Bringing business and financial analysis to the 'tidyverse'. The 'tidyquant' package provides a convenient wrapper to various 'xts', 'zoo', 'quantmod', 'TTR' and 'PerformanceAnalytics' package functions and returns the objects in the tidy 'tibble' format. The main advantage is being able to use quantitative functions with the 'tidyverse' functions including 'purrr', 'dplyr', 'tidyr', 'ggplot2', 'lubridate', etc. See the 'tidyquant' website for more information, documentation and examples.
Maintained by Matt Dancho. Last updated 2 months ago.
dplyrfinancial-analysisfinancial-datafinancial-statementsmultiple-stocksperformance-analysisperformanceanalyticsquantmodstockstock-exchangesstock-indexesstock-listsstock-performancestock-pricesstock-symboltidyversetime-seriestimeseriesxts
9.1 match 872 stars 13.34 score 5.2k scriptsropensci
tradestatistics:Open Trade Statistics API Wrapper and Utility Program
Access 'Open Trade Statistics' API from R to download international trade data.
Maintained by Mauricio Vargas. Last updated 7 months ago.
api-wrapperdata-tableinternational-tradejsonliteopen-trade-statistics
16.6 match 77 stars 7.15 score 92 scriptshimesgroup
raqs:Interface to the US EPA Air Quality System (AQS) API
Offers functions for fetching JSON data from the US EPA Air Quality System (AQS) API with options to comply with the API rate limits. See <https://aqs.epa.gov/aqsweb/documents/data_api.html> for details of the AQS API.
Maintained by Jaehyun Joo. Last updated 1 years ago.
37.3 match 3.18 score 4 scripts 1 dependentsirudnyts
openai:R Wrapper for OpenAI API
An R wrapper of OpenAI API endpoints (see <https://platform.openai.com/docs/introduction> for details). This package covers Models, Completions, Chat, Edits, Images, Embeddings, Audio, Files, Fine-tunes, Moderations, and legacy Engines endpoints.
Maintained by Iegor Rudnytskyi. Last updated 5 months ago.
14.6 match 172 stars 8.05 score 336 scripts 5 dependentsropensci
opencage:Geocode with the OpenCage API
Geocode with the OpenCage API, either from place name to longitude and latitude (forward geocoding) or from longitude and latitude to the name and address of a location (reverse geocoding), see <https://opencagedata.com>.
Maintained by Daniel Possenriede. Last updated 2 months ago.
geocodegeocoderopencageopencage-apiopencage-geocoderpeer-reviewedplacenamesrspatial
14.0 match 86 stars 8.39 score 79 scriptsjonthegeek
rapid:R 'API' Descriptions
Convert an 'API' description ('APID'), such as one that follows the 'OpenAPI Specification', to an R 'API' description object (a "rapid"). The rapid object follows the 'OpenAPI Specification' to make it easy to convert to and from 'API' documents.
Maintained by Jon Harmon. Last updated 4 months ago.
27.1 match 9 stars 4.28 score 10 scripts 2 dependentsts404
WikidataR:Read-Write API Client Library for Wikidata
Read from, interrogate, and write to Wikidata <https://www.wikidata.org> - the multilingual, interdisciplinary, semantic knowledgebase. Includes functions to: read from Wikidata (single items, properties, or properties); query Wikidata (retrieving all items that match a set of criteria via Wikidata SPARQL query service); write to Wikidata (adding new items or statements via QuickStatements); and handle and manipulate Wikidata objects (as lists and tibbles). Uses the Wikidata and QuickStatements APIs.
Maintained by Thomas Shafee. Last updated 2 months ago.
12.8 match 22 stars 9.01 score 109 scripts 28 dependentsr-spatial
rgee:R Bindings for Calling the 'Earth Engine' API
Earth Engine <https://earthengine.google.com/> client library for R. All of the 'Earth Engine' API classes, modules, and functions are made available. Additional functions implemented include importing (exporting) of Earth Engine spatial objects, extraction of time series, interactive map display, assets management interface, and metadata display. See <https://r-spatial.github.io/rgee/> for further details.
Maintained by Cesar Aybar. Last updated 3 hours ago.
earth-engineearthenginegoogle-earth-enginegoogleearthenginespatial-analysisspatial-data
8.4 match 721 stars 13.78 score 1.9k scripts 3 dependentsfkoh111
zzlite:Lite Wrapper for the 'Zamzar File Conversion' API
A minor collection of HTTP wrappers for the 'Zamzar File Conversion' API. The wrappers makes it easy to utilize the API and thus convert between more than 100 different file formats (ranging from audio files, images, movie formats, etc., etc.) through an R session. For specifics regarding the API, please see <https://developers.zamzar.com/>.
Maintained by Frederik Kok Hansen. Last updated 5 years ago.
apiapi-wrapperconversionzamzar-api
31.1 match 3.70 score 1 scriptsjchrom
trelloR:Access the Trello API
An R client for the Trello API. Supports free-tier features such as access to private boards, creating and updating cards and other resources, and downloading data in a structured way.
Maintained by Jakub Chromec. Last updated 2 years ago.
18.6 match 42 stars 6.18 score 24 scriptsmassimoaria
dimensionsR:Gathering Bibliographic Records from 'Digital Science Dimensions' Using 'DSL' API
A set of tools to extract bibliographic content from 'Digital Science Dimensions' using 'DSL' API <https://www.dimensions.ai/dimensions-apis/>.
Maintained by Massimo Aria. Last updated 1 years ago.
bibliographic-databasebibliographybibliometricsbibliometrixclinical-trialsds-dimensionsdsl-apigathering-bibliographic-recordsgrantgrantsgrants-searchpatentspolicy-documentspublicationspublications-search
15.9 match 42 stars 7.23 score 7 scripts 3 dependentsdaroczig
fbRads:Analyzing and Managing Facebook Ads from R
Wrapper functions around the Facebook Marketing 'API' to create, read, update and delete custom audiences, images, campaigns, ad sets, ads and related content.
Maintained by Gergely Daroczi. Last updated 1 years ago.
adtechfacebookfacebook-adsfacebook-apifacebook-marketing-apimarketing
20.0 match 153 stars 5.72 score 17 scriptsgiscience
ohsome:An 'ohsome API' Client
A client that grants access to the power of the 'ohsome API' from R. It lets you analyze the rich data source of the 'OpenStreetMap (OSM)' history. You can retrieve the geometry of 'OSM' data at specific points in time, and you can get aggregated statistics on the evolution of 'OSM' elements and specify your own temporal, spatial and/or thematic filters.
Maintained by Oliver Fritz. Last updated 2 years ago.
heigitohsomeopenstreetmapopenstreetmap-dataopenstreetmap-historyosmosm-data
22.4 match 11 stars 5.04 score 9 scriptsvalerivoev
danstat:R Client for the Statistics Denmark Databank API
The purpose of the package is to enable an R function interface into the Statistics Denmark Databank API mainly for research purposes. The Statistics Denmark Databank API has four endpoints, see here for more information and testing the API in their console: <https://www.dst.dk/en/Statistik/brug-statistikken/muligheder-i-statistikbanken/api>. This package mimics the structure of the API and provides four main functions to match the functionality of the API endpoints.
Maintained by Valeri Voev. Last updated 3 years ago.
23.9 match 6 stars 4.73 score 18 scriptscmu-delphi
epidatr:Client for Delphi's 'Epidata' API
The Delphi 'Epidata' API provides real-time access to epidemiological surveillance data for influenza, 'COVID-19', and other diseases for the USA at various geographical resolutions, both from official government sources such as the Center for Disease Control (CDC) and Google Trends and private partners such as Facebook and Change 'Healthcare'. It is built and maintained by the Carnegie Mellon University Delphi research group. To cite this API: David C. Farrow, Logan C. Brooks, Aaron 'Rumack', Ryan J. 'Tibshirani', 'Roni' 'Rosenfeld' (2015). Delphi 'Epidata' API. <https://github.com/cmu-delphi/delphi-epidata>.
Maintained by David Weber. Last updated 11 days ago.
14.6 match 5 stars 7.71 score 114 scriptsglobalfishingwatch
gfwr:Access data from Global Fishing Watch APIs
This package connects to several Global Fishing Watch APIs to get vessel and events information in an R-friendly format.
Maintained by Andrea Sánchez-Tapia. Last updated 2 months ago.
aisais-dataapi-wrapperglobalfishingwatchmapping
19.4 match 66 stars 5.82 score 66 scriptswalkerke
mapboxapi:R Interface to 'Mapbox' Web Services
Includes support for 'Mapbox' Navigation APIs, including directions, isochrones, and route optimization; the Search API for forward and reverse geocoding; the Maps API for interacting with 'Mapbox' vector tilesets and visualizing 'Mapbox' maps in R; and 'Mapbox Tiling Service' and 'tippecanoe' for generating map tiles. See <https://docs.mapbox.com/api/> for more information about the 'Mapbox' APIs.
Maintained by Kyle Walker. Last updated 2 months ago.
14.7 match 113 stars 7.62 score 304 scriptsvusaverse
vvtableau:R Interface for 'Tableau' Services
Provides an R interface for interacting with the 'Tableau' Server. It allows users to perform various operations such as publishing workbooks, refreshing data extracts, and managing users using the 'Tableau' REST API (see <https://help.tableau.com/current/api/rest_api/en-us/REST/rest_api_ref.htm> for details). Additionally, it includes functions to perform manipulations on local 'Tableau' workbooks.
Maintained by Tomer Iwan. Last updated 7 months ago.
rest-apitableautableau-dashboardstableau-desktoptableau-rest-apitableau-server
18.3 match 7 stars 6.13 score 16 scriptsaschleg
PetfindeR:'Petfinder' API Wrapper
Wrapper of the 'Petfinder API' <https://www.petfinder.com/developers/v2/docs/> that implements methods for interacting with and extracting data from the 'Petfinder' database. The 'Petfinder REST API' allows access to the 'Petfinder' database, one of the largest online databases of adoptable animals and animal welfare organizations across North America.
Maintained by Aaron Schlegel. Last updated 5 years ago.
animal-shelteranimal-welfare-organizationsanimalsapi-wrapperpetfinderpetfinder-apipetfinder-database
25.0 match 6 stars 4.48 score 6 scriptsstatistikat
STATcubeR:R Interface for the 'STATcube' REST API and Open Government Data
Import data from the 'STATcube' REST API or from the open data portal of Statistics Austria. This package includes a client for API requests as well as parsing utilities for data which originates from 'STATcube'. Documentation about 'STATcubeR' is provided by several vignettes included in the package as well as on the public 'pkgdown' page at <https://statistikat.github.io/STATcubeR/>.
Maintained by Bernhard Meindl. Last updated 4 months ago.
22.1 match 18 stars 5.03 score 9 scriptsropensci
spocc:Interface to Species Occurrence Data Sources
A programmatic interface to many species occurrence data sources, including Global Biodiversity Information Facility ('GBIF'), 'iNaturalist', 'eBird', Integrated Digitized 'Biocollections' ('iDigBio'), 'VertNet', Ocean 'Biogeographic' Information System ('OBIS'), and Atlas of Living Australia ('ALA'). Includes functionality for retrieving species occurrence data, and combining those data.
Maintained by Hannah Owens. Last updated 2 months ago.
specimensapiweb-servicesoccurrencesspeciestaxonomygbifinatvertnetebirdidigbioobisalaantwebbisondataecoengineinaturalistoccurrencespecies-occurrencespocc
11.0 match 118 stars 10.09 score 552 scripts 5 dependentsropensci
vcr:Record 'HTTP' Calls to Disk
Record test suite 'HTTP' requests and replays them during future runs. A port of the Ruby gem of the same name (<https://github.com/vcr/vcr/>). Works by hooking into the 'webmockr' R package for matching 'HTTP' requests by various rules ('HTTP' method, 'URL', query parameters, headers, body, etc.), and then caching real 'HTTP' responses on disk in 'cassettes'. Subsequent 'HTTP' requests matching any previous requests in the same 'cassette' use a cached 'HTTP' response.
Maintained by Scott Chamberlain. Last updated 27 days ago.
httphttpsapiweb-servicescurlmockmockinghttp-mockingtestingtesting-toolstddunit-testingvcr
11.0 match 77 stars 10.06 score 165 scriptsusa-npn
rnpn:Interface to the National 'Phenology' Network 'API'
Programmatic interface to the Web Service methods provided by the National 'Phenology' Network (<https://usanpn.org/>), which includes data on various life history events that occur at specific times.
Maintained by Jeff Switzer. Last updated 5 days ago.
datanational-phenology-networkphenologyspeciesweb-api
12.3 match 21 stars 8.91 score 109 scriptsdietrichson
ProPublicaR:Access Functions for ProPublica's APIs
Provides wrapper functions to access the ProPublica's Congress and Campaign Finance APIs. The Congress API provides near real-time access to legislative data from the House of Representatives, the Senate and the Library of Congress. The Campaign Finance API provides data from United States Federal Election Commission filings and other sources. The API covers summary information for candidates and committees, as well as certain types of itemized data. For more information about these APIs go to: <https://www.propublica.org/datastore/apis>.
Maintained by Aleksander Dietrichson. Last updated 2 years ago.
25.0 match 12 stars 4.38 score 1 scriptsbradlindblad
proverbs:Print a Daily Bible Proverb to Console
A simple package to grab a Bible proverb corresponding to the day of the month.
Maintained by Brad Lindblad. Last updated 1 years ago.
apibible-apibible-studybible-translations
22.8 match 6 stars 4.78 score 6 scriptsnealrichardson
httptest:A Test Environment for HTTP Requests
Testing and documenting code that communicates with remote servers can be painful. Dealing with authentication, server state, and other complications can make testing seem too costly to bother with. But it doesn't need to be that hard. This package enables one to test all of the logic on the R sides of the API in your package without requiring access to the remote service. Importantly, it provides three contexts that mock the network connection in different ways, as well as testing functions to assert that HTTP requests were---or were not---made. It also allows one to safely record real API responses to use as test fixtures. The ability to save responses and load them offline also enables one to write vignettes and other dynamic documents that can be distributed without access to a live server.
Maintained by Neal Richardson. Last updated 1 years ago.
11.5 match 81 stars 9.46 score 276 scripts 1 dependentsgiocomai
cornucopia:A cornucopia is like a funnel that keeps on giving
Facilitate reporting on sponsored and organic activities on Facebook, Instagram, and LinkedIn (currently), estimate and visualise the result of marketing funnels (long term)
Maintained by Giorgio Comai. Last updated 4 days ago.
facebookfacebook-apifacebook-graph-apiinstagraminstagram-apilinkedinmarketing-api
40.9 match 2.65 scorerexyai
RestRserve:A Framework for Building HTTP API
Allows to easily create high-performance full featured HTTP APIs from R functions. Provides high-level classes such as 'Request', 'Response', 'Application', 'Middleware' in order to streamline server side application development. Out of the box allows to serve requests using 'Rserve' package, but flexible enough to integrate with other HTTP servers such as 'httpuv'.
Maintained by Dmitry Selivanov. Last updated 14 days ago.
http-serveropenapirest-apiswagger-uicpp
11.1 match 283 stars 9.74 score 95 scripts 1 dependentsocha-dap
ripc:Download and Tidy IPC and CH Data
Utilities to access Integrated Food Security Phase Classification (IPC) and Cadre Harmonisé (CH) food security data. Wrapper functions are available for all of the 'IPC-CH' Public API (<https://docs.api.ipcinfo.org>) simplified and advanced endpoints to easily download the data in a clean and tidy format.
Maintained by Seth Caldwell. Last updated 9 months ago.
23.0 match 2 stars 4.70 score 4 scriptscezarykuran
oaii:'OpenAI' API R Interface
A comprehensive set of helpers that streamline data transmission and processing, making it effortless to interact with the 'OpenAI' API.
Maintained by Cezary Kuran. Last updated 1 years ago.
107.4 match 1.00 score 1 scriptsselesnow
rgoogleads:Loading Data from 'Google Ads API'
Interface for loading data from 'Google Ads API', see <https://developers.google.com/google-ads/api/docs/start>. Package provide function for authorization and loading reports.
Maintained by Alexey Seleznev. Last updated 3 months ago.
16.7 match 14 stars 6.40 score 15 scripts 1 dependentsploner
RMixpanel:API for Mixpanel
Provides an interface to many endpoints of Mixpanel's Data Export, Engage and JQL API. The R functions allow for event and profile data export as well as for segmentation, retention, funnel and addiction analysis. Results are always parsed into convenient R objects. Furthermore it is possible to load and update profiles.
Maintained by Meinhard Ploner. Last updated 6 years ago.
analyticsmixpanelmixpanel-apitracking
26.7 match 18 stars 4.00 score 11 scriptsbioc
VariantAnnotation:Annotation of Genetic Variants
Annotate variants, compute amino acid coding changes, predict coding outcomes.
Maintained by Bioconductor Package Maintainer. Last updated 3 months ago.
dataimportsequencingsnpannotationgeneticsvariantannotationcurlbzip2xz-utilszlib
9.3 match 11.39 score 1.9k scripts 152 dependentsjasonjfoster
screen:Yahoo Finance Screener
Fast and efficient access to Yahoo Finance's screener functionality for querying and retrieval of financial data.
Maintained by Jason Foster. Last updated 2 hours ago.
39.1 match 1 stars 2.70 scoresimpar1471
openFDA:'openFDA' API
The 'openFDA' API facilitates access to U.S. Food and Drug Administration (FDA) data on drugs, devices, foodstuffs, tobacco, and more with 'httr2'. This package makes the API easily accessible, returning objects which the user can convert to JSON data and parse. Kass-Hout TA, Xu Z, Mohebbi M et al. (2016) <doi:10.1093/jamia/ocv153>.
Maintained by Simon Parker. Last updated 5 months ago.
21.9 match 1 stars 4.81 score 128 scriptsrstudio
rstudioapi:Safely Access the RStudio API
Access the RStudio API (if available) and provide informative error messages when it's not.
Maintained by Kevin Ushey. Last updated 5 months ago.
5.6 match 172 stars 18.81 score 3.6k scripts 2.1k dependentsbioc
GenomicDataCommons:NIH / NCI Genomic Data Commons Access
Programmatically access the NIH / NCI Genomic Data Commons RESTful service.
Maintained by Sean Davis. Last updated 2 months ago.
dataimportsequencingapi-clientbioconductorbioinformaticscancercore-servicesdata-sciencegenomicsncitcgavignette
8.7 match 87 stars 11.94 score 238 scripts 12 dependentsdheerajagarwal
rgdax:Wrapper for 'Coinbase Pro (erstwhile GDAX)' Cryptocurrency Exchange
Allow access to both public and private end points to Coinbase Pro (erstwhile GDAX) cryptocurrency exchange. For authenticated flow, users must have valid api, secret and passphrase to be able to connect.
Maintained by Dheeraj Agarwal. Last updated 1 years ago.
coinbase-procoinbase-pro-apicoinbaseprocoinbasepro-apicryptocurrencygdaxgdax-rlibrarymit-licenserstudiounofficial-wrapperswrapper
19.9 match 34 stars 5.23 score 33 scriptsjohannesfriedrich
hystReet:Get Pedestrian Frequency Data from the 'Hystreet' Project
An R API wrapper for the 'Hystreet' project <https://hystreet.com>. 'Hystreet' provides pedestrian counts in different cities in Germany.
Maintained by Johannes Friedrich. Last updated 2 months ago.
apibigdatahystreetpedestrian-detectionwrapper
19.6 match 13 stars 5.29 score 9 scriptsmoosa-r
rbioapi:User-Friendly R Interface to Biologic Web Services' API
Currently fully supports Enrichr, JASPAR, miEAA, PANTHER, Reactome, STRING, and UniProt! The goal of rbioapi is to provide a user-friendly and consistent interface to biological databases and services. In a way that insulates the user from the technicalities of using web services API and creates a unified and easy-to-use interface to biological and medical web services. This is an ongoing project; New databases and services will be added periodically. Feel free to suggest any databases or services you often use.
Maintained by Moosa Rezwani. Last updated 2 months ago.
api-clientbioinformaticsbiologyenrichmentenrichment-analysisenrichrjasparmieaaover-representation-analysispantherreactomestringuniprot
13.6 match 20 stars 7.60 score 55 scriptseblondel
rsdmx:Tools for Reading SDMX Data and Metadata
Set of classes and methods to read data and metadata documents exchanged through the Statistical Data and Metadata Exchange (SDMX) framework, currently focusing on the SDMX XML standard format (SDMX-ML).
Maintained by Emmanuel Blondel. Last updated 5 hours ago.
apidatastructuresdsdreadreadsdmxsdmxsdmx-formatsdmx-providersdmx-standardsstatisticstimeseriesweb-services
11.0 match 105 stars 9.36 score 4 dependentsgesistsa
rtoot:Collecting and Analyzing Mastodon Data
An implementation of calls designed to collect and organize Mastodon data via its Application Program Interfaces (API), which can be found at the following URL: <https://docs.joinmastodon.org/>.
Maintained by David Schoch. Last updated 2 months ago.
11.8 match 105 stars 8.70 score 67 scriptsigrave
ladder.api:Google Slides API client and tools
Create, read and modify Slides presentations with full REST API functionality.
Maintained by Isaac Gravestock. Last updated 8 months ago.
42.7 match 2.40 scoremikkelvembye
AIscreenR:AI Screening Tools in R for Systematic Reviewing
Provides functions to conduct title and abstract screening in systematic reviews using large language models, such as the Generative Pre-trained Transformer (GPT) models from 'OpenAI' <https://platform.openai.com/>. These functions can enhance the quality of title and abstract screenings while reducing the total screening time significantly. In addition, the package includes tools for quality assessment of title and abstract screenings, as described in Vembye, Christensen, Mølgaard, and Schytt (2024) <DOI:10.31219/osf.io/yrhzm>.
Maintained by Mikkel H. Vembye. Last updated 3 months ago.
gptopenaiscreeningsystematic-review
16.7 match 10 stars 6.11 score 7 scriptsilostat
Rilostat:ILO Open Data via Ilostat Bulk Download Facility
Tools to download data from the [ilostat](<https://ilostat.ilo.org>) database together with search and manipulation utilities.
Maintained by David Bescond. Last updated 21 days ago.
apidatasetopen-sourcepublic-api
18.5 match 34 stars 5.47 score 43 scriptsalshum
rwunderground:R Interface to Weather Underground API
Tools for getting historical weather information and forecasts from wunderground.com. Historical weather and forecast data includes, but is not limited to, temperature, humidity, windchill, wind speed, dew point, heat index. Additionally, the weather underground weather API also includes information on sunrise/sunset, tidal conditions, satellite/webcam imagery, weather alerts, hurricane alerts and historical high/low temperatures.
Maintained by Eric Hare. Last updated 7 years ago.
weatherweather-dataweather-historyweather-underground
16.2 match 77 stars 6.20 score 83 scriptslbilli
rib:An Implementation of 'Interactive Brokers' API
Allows interaction with 'Interactive Brokers' 'Trader Workstation' <https://interactivebrokers.github.io/tws-api/>. Handles the connection over the network and the exchange of messages. Data is encoded and decoded between user and wire formats. Data structures and functionality closely mirror the official implementations.
Maintained by Luca Billi. Last updated 25 days ago.
api-clientib-apiinteractive-brokers
18.6 match 39 stars 5.37 score 3 scriptsiqss
dataverse:Client for Dataverse 4+ Repositories
Provides access to Dataverse APIs <https://dataverse.org/> (versions 4-5), enabling data search, retrieval, and deposit. For Dataverse versions <= 3.0, use the archived 'dvn' package <https://cran.r-project.org/package=dvn>.
Maintained by Shiro Kuriwaki. Last updated 6 months ago.
datadata-depositdataversedataverse-apisword
10.0 match 61 stars 9.98 score 217 scripts 4 dependentspaws-r
paws.common:Paws Low-Level Amazon Web Services API
Functions for making low-level API requests to Amazon Web Services <https://aws.amazon.com>. The functions handle building, signing, and sending requests, and receiving responses. They are designed to help build higher-level interfaces to individual services, such as Simple Storage Service (S3).
Maintained by Dyfan Jones. Last updated 19 days ago.
8.9 match 332 stars 11.07 score 39 dependentsbioc
RCy3:Functions to Access and Control Cytoscape
Vizualize, analyze and explore networks using Cytoscape via R. Anything you can do using the graphical user interface of Cytoscape, you can now do with a single RCy3 function.
Maintained by Alex Pico. Last updated 5 days ago.
visualizationgraphandnetworkthirdpartyclientnetwork
7.3 match 52 stars 13.47 score 628 scripts 17 dependentsdementiy
vkR:Access to VK API via R
Provides an interface to the VK API <https://vk.com/dev/methods>. VK <https://vk.com/> is the largest European online social networking service, based in Russia.
Maintained by Dmitriy Sorokin. Last updated 5 years ago.
18.3 match 56 stars 5.36 score 41 scriptsropensci
roreviewapi:Plumber API to report package structure and function
Plumber API to report package structure and function.
Maintained by Mark Padgham. Last updated 1 months ago.
18.6 match 4 stars 5.26 scorenik01010
openbankeR:R Client for Querying the UK 'Open Banking' ('Open Data') API
Creates a client with queries for the UK 'Open Banking' ('Open Data') API. API wrapper around <https://openbankinguk.github.io/opendata-api-docs-pub>.
Maintained by Nik Lilovski. Last updated 3 years ago.
bankclientdataopenbankingopenbanking-apiopendataopendata-api
21.8 match 6 stars 4.48 score 6 scriptsr-lib
gitcreds:Query 'git' Credentials from 'R'
Query, set, delete credentials from the 'git' credential store. Manage 'GitHub' tokens and other 'git' credentials. This package is to be used by other packages that need to authenticate to 'GitHub' and/or other 'git' repositories.
Maintained by Gábor Csárdi. Last updated 8 months ago.
credentialscredentials-helpergitgithub
7.2 match 28 stars 13.31 score 372 scripts 407 dependentstpisel
openmeteo:Retrieve Weather Data from the Open-Meteo API
A client for the Open-Meteo API that retrieves Open-Meteo weather data in a tidy format. No API key is required. The API specification is located at <https://open-meteo.com/en/docs>.
Maintained by Tom Pisel. Last updated 1 years ago.
19.4 match 20 stars 4.93 score 86 scriptsrblp
Rblpapi:R Interface to 'Bloomberg'
An R Interface to 'Bloomberg' is provided via the 'Blp API'.
Maintained by Dirk Eddelbuettel. Last updated 6 hours ago.
9.9 match 169 stars 9.49 score 115 scriptsjoshuaulrich
IBrokers:R API to Interactive Brokers Trader Workstation
Provides native R access to Interactive Brokers Trader Workstation API.
Maintained by Joshua M. Ulrich. Last updated 7 months ago.
12.4 match 70 stars 7.59 score 93 scriptsamerican-soccer-analysis
itscalledsoccer:American Soccer Analysis API Client
Provides a wrapper around the same API <https://app.americansocceranalysis.com/api/v1/__docs__/> that powers the American Soccer Analysis app.
Maintained by Tyler Richardett. Last updated 2 months ago.
api-wrapperitscalledsoccersoccersoccer-api
20.6 match 6 stars 4.56 score 3 scriptsmatthewjrogers
rairtable:Efficient Wrapper for the 'Airtable' API
Efficient CRUD interface for the 'Airtable' API <https://airtable.com/developers/web/api>, supporting batch requests and parallel encoding of large data sets.
Maintained by Matthew Rogers. Last updated 2 years ago.
airtableairtable-apiapi-client
20.8 match 13 stars 4.53 score 26 scriptsappsilon
shiny.semantic:Semantic UI Support for Shiny
Creating a great user interface for your Shiny apps can be a hassle, especially if you want to work purely in R and don't want to use, for instance HTML templates. This package adds support for a powerful UI library Fomantic UI - <https://fomantic-ui.com/> (before Semantic). It also supports universal UI input binding that works with various DOM elements.
Maintained by Jakub Nowicki. Last updated 12 months ago.
appsilonfomantic-uirhinoversesemanticsemantic-componentssemantic-uishiny
7.2 match 506 stars 13.00 score 586 scripts 3 dependentscurso-r
scryr:An Interface to the 'Scryfall' API
A simple, light, and robust interface between R and the 'Scryfall' card data API <https://scryfall.com/docs/api>.
Maintained by Caio Lente. Last updated 3 years ago.
15.2 match 18 stars 6.11 score 18 scriptsjemus42
tRakt:Get Data from 'trakt.tv'
A wrapper for the <https://trakt.tv> API to retrieve data about shows and movies, including user ratings, credits and related metadata. Additional functions retrieve user-specific information including collections and history of watched items. A full API reference is available at <https://trakt.docs.apiary.io>.
Maintained by Lukas Burk. Last updated 15 days ago.
15.2 match 22 stars 6.12 score 33 scriptsstatisticspoland
bdl:Interface and Tools for 'BDL' API
Interface to Local Data Bank ('Bank Danych Lokalnych' - 'bdl') API <https://api.stat.gov.pl/Home/BdlApi?lang=en> with set of useful tools like quick plotting and map generating using data from bank.
Maintained by Krzysztof Kania. Last updated 2 years ago.
16.1 match 20 stars 5.74 score 11 scriptsphippsy
brandwatchR:'Brandwatch' API to R
Interact with the 'Brandwatch' API <https://developers.brandwatch.com/docs>. Allows you to authenticate to the API and obtain data for projects, queries, query groups tags and categories. Also allows you to directly obtain mentions and aggregate data for a specified query or query group.
Maintained by Donal Phipps. Last updated 7 years ago.
22.3 match 11 stars 4.16 score 26 scriptsropensci
neotoma:Access to the Neotoma Paleoecological Database Through R
NOTE: This package is deprecated. Please use the neotoma2 package described at https://github.com/NeotomaDB/neotoma2. Access paleoecological datasets from the Neotoma Paleoecological Database using the published API (<http://wnapi.neotomadb.org/>), only containing datasets uploaded prior to June 2020. The functions in this package access various pre-built API functions and attempt to return the results from Neotoma in a usable format for researchers and the public.
Maintained by Simon J. Goring. Last updated 2 years ago.
neotomaneotoma-apisneotoma-databasensfpaleoecology
18.4 match 30 stars 5.04 score 145 scriptsnikdata
RClimacell:R Wrapper for the 'Climacell' API
'Climacell' is a weather platform that provides hyper-local forecasts and weather data. This package enables the user to query the core layers of the time line interface of the 'Climacell' v4 API <https://www.climacell.co/weather-api/>. This package requires a valid API key. See vignettes for instructions on use.
Maintained by Nikhil Agarwal. Last updated 4 years ago.
climacellclimacell-apiweatherweather-api
23.1 match 4.00 score 5 scriptsropensci
aRxiv:Interface to the arXiv API
An interface to the API for 'arXiv', a repository of electronic preprints for computer science, mathematics, physics, quantitative biology, quantitative finance, and statistics.
Maintained by Karl Broman. Last updated 1 years ago.
arxivarxiv-analyticsarxiv-apiarxiv-org
13.2 match 63 stars 6.97 score 74 scriptschuhousen
amerifluxr:Interface to 'AmeriFlux' Data Services
Programmatic interface to the 'AmeriFlux' database (<https://ameriflux.lbl.gov/>). Provide query, download, and data summary tools.
Maintained by Housen Chu. Last updated 3 months ago.
amerifluxapicarbon-fluxdatatime-series
11.0 match 22 stars 8.36 score 29 scripts 15 dependentsr-box
boxr:Interface for the 'Box.com API'
An R interface for the remote file hosting service 'Box' (<https://www.box.com/>). In addition to uploading and downloading files, this package includes functions which mirror base R operations for local files, (e.g. box_load(), box_save(), box_read(), box_setwd(), etc.), as well as 'git' style functions for entire directories (e.g. box_fetch(), box_push()).
Maintained by Ian Lyttle. Last updated 12 months ago.
10.6 match 63 stars 8.65 score 238 scriptsropensci
fingertipsR:Fingertips Data for Public Health
Fingertips (<http://fingertips.phe.org.uk/>) contains data for many indicators of public health in England. The underlying data is now more easily accessible by making use of the API.
Maintained by Annabel Westermann. Last updated 1 years ago.
api-wrapperfingertipshealthopen-datapeer-reviewedpublic-healthpublic-health-england
11.6 match 96 stars 7.89 score 268 scripts 1 dependentsropensci
webmockr:Stubbing and Setting Expectations on 'HTTP' Requests
Stubbing and setting expectations on 'HTTP' requests. Includes tools for stubbing 'HTTP' requests, including expected request conditions and response conditions. Match on 'HTTP' method, query parameters, request body, headers and more. Can be used for unit tests or outside of a testing context.
Maintained by Scott Chamberlain. Last updated 2 months ago.
httphttpsapiweb-servicescurlmockmockingfakewebhttp-mockingtestingtesting-toolstddhttp-mock
11.0 match 49 stars 8.29 score 141 scripts 1 dependentsrekyt
rtaxref:An R client for TaxRef the French Taxonomical Database
Provides an R client to the TaxRef API <https://taxref.mnhn.fr/taxref-web/api/doc>, the French Taxonomical Reference Database which indexes names of species with unique identifiers as well as conservation statuses, biological interactions and taxonomic relationships.
Maintained by Matthias Grenié. Last updated 3 years ago.
apiapi-clientapi-wrapperbiodiversitytaxonomy
26.8 match 5 stars 3.40 score 5 scriptseglenn
acs:Download, Manipulate, and Present American Community Survey and Decennial Data from the US Census
Provides a general toolkit for downloading, managing, analyzing, and presenting data from the U.S. Census (<https://www.census.gov/data/developers/data-sets.html>), including SF1 (Decennial short-form), SF3 (Decennial long-form), and the American Community Survey (ACS). Confidence intervals provided with ACS data are converted to standard errors to be bundled with estimates in complex acs objects. Package provides new methods to conduct standard operations on acs objects and present/plot data in statistically appropriate ways.
Maintained by Ezra Haber Glenn. Last updated 6 years ago.
16.9 match 11 stars 5.33 score 430 scripts 3 dependents