Showing 200 of total 5263 results (show query)
rstudio
rmarkdown:Dynamic Documents for R
Convert R Markdown documents into a variety of formats.
Maintained by Yihui Xie. Last updated 3 hours ago.
literate-programmingmarkdownpandocrmarkdown
2.9k stars 21.80 score 14k scripts 3.7k dependentsrstudio
shiny:Web Application Framework for R
Makes it incredibly easy to build interactive web applications with R. Automatic "reactive" binding between inputs and outputs and extensive prebuilt widgets make it possible to build beautiful, responsive, and powerful applications with minimal effort.
Maintained by Winston Chang. Last updated 6 days ago.
reactiverstudioshinyweb-appweb-development
5.5k stars 21.31 score 108k scripts 1.8k dependentsr-lib
testthat:Unit Testing for R
Software testing is important, but, in part because it is frustrating and boring, many of us avoid it. 'testthat' is a testing framework for R that is easy to learn and use, and integrates with your existing 'workflow'.
Maintained by Hadley Wickham. Last updated 1 months ago.
900 stars 20.99 score 74k scripts 471 dependentstidyverse
tidyverse:Easily Install and Load the 'Tidyverse'
The 'tidyverse' is a set of packages that work in harmony because they share common data representations and 'API' design. This package is designed to make it easy to install and load multiple 'tidyverse' packages in a single step. Learn more about the 'tidyverse' at <https://www.tidyverse.org>.
Maintained by Hadley Wickham. Last updated 5 months ago.
1.7k stars 20.23 score 664k scripts 125 dependentsr-lib
devtools:Tools to Make Developing R Packages Easier
Collection of package development tools.
Maintained by Jennifer Bryan. Last updated 6 months ago.
2.4k stars 19.55 score 51k scripts 150 dependentsplotly
plotly:Create Interactive Web Graphics via 'plotly.js'
Create interactive web graphics from 'ggplot2' graphs and/or a custom interface to the (MIT-licensed) JavaScript library 'plotly.js' inspired by the grammar of graphics.
Maintained by Carson Sievert. Last updated 4 months ago.
d3jsdata-visualizationggplot2javascriptplotlyshinywebgl
2.6k stars 19.43 score 93k scripts 797 dependentshaozhu233
kableExtra:Construct Complex Table with 'kable' and Pipe Syntax
Build complex HTML or 'LaTeX' tables using 'kable()' from 'knitr' and the piping syntax from 'magrittr'. Function 'kable()' is a light weight table generator coming from 'knitr'. This package simplifies the way to manipulate the HTML or 'LaTeX' codes generated by 'kable()' and allows users to construct complex tables and customize styles using a readable syntax.
Maintained by Hao Zhu. Last updated 25 days ago.
htmlkablekableextraknitrlatexrmarkdown
702 stars 19.35 score 55k scripts 163 dependentsrstudio
DT:A Wrapper of the JavaScript Library 'DataTables'
Data objects in R can be rendered as HTML tables using the JavaScript library 'DataTables' (typically via R Markdown or Shiny). The 'DataTables' library has been included in this R package. The package name 'DT' is an abbreviation of 'DataTables'.
Maintained by Joe Cheng. Last updated 4 months ago.
datatableshtmlwidgetsjavascriptshiny
604 stars 19.15 score 38k scripts 673 dependentsramnathv
htmlwidgets:HTML Widgets for R
A framework for creating HTML widgets that render in various contexts including the R console, 'R Markdown' documents, and 'Shiny' web applications.
Maintained by Carson Sievert. Last updated 1 years ago.
791 stars 19.05 score 7.4k scripts 3.1k dependentsr-lib
roxygen2:In-Line Documentation for R
Generate your Rd documentation, 'NAMESPACE' file, and collation field using specially formatted comments. Writing documentation in-line with code makes it easier to keep your documentation up-to-date as your requirements change. 'roxygen2' is inspired by the 'Doxygen' system for C++.
Maintained by Hadley Wickham. Last updated 8 months ago.
606 stars 18.51 score 2.3k scripts 219 dependentsr-lib
pkgdown:Make Static HTML Documentation for a Package
Generate an attractive and useful website from a source package. 'pkgdown' converts your documentation, vignettes, 'README', and more to 'HTML' making it easy to share information about your package online.
Maintained by Hadley Wickham. Last updated 12 days ago.
734 stars 18.46 score 588 scripts 162 dependentsrstudio
gt:Easily Create Presentation-Ready Display Tables
Build display tables from tabular data with an easy-to-use set of functions. With its progressive approach, we can construct display tables with a cohesive set of table parts. Table values can be formatted using any of the included formatting functions. Footnotes and cell styles can be precisely added through a location targeting system. The way in which 'gt' handles things for you means that you don't often have to worry about the fine details.
Maintained by Richard Iannone. Last updated 26 days ago.
docxeasy-to-usehtmllatexrtfsummary-tables
2.1k stars 18.36 score 20k scripts 112 dependentsrstudio
bslib:Custom 'Bootstrap' 'Sass' Themes for 'shiny' and 'rmarkdown'
Simplifies custom 'CSS' styling of both 'shiny' and 'rmarkdown' via 'Bootstrap' 'Sass'. Supports 'Bootstrap' 3, 4 and 5 as well as their various 'Bootswatch' themes. An interactive widget is also provided for previewing themes in real time.
Maintained by Carson Sievert. Last updated 26 days ago.
bootstraphtmltoolsrmarkdownsassshiny
511 stars 18.02 score 5.1k scripts 4.3k dependentsharrelfe
Hmisc:Harrell Miscellaneous
Contains many functions useful for data analysis, high-level graphics, utility operations, functions for computing sample size and power, simulation, importing and annotating datasets, imputing missing values, advanced table making, variable clustering, character string manipulation, conversion of R objects to LaTeX and html code, recoding variables, caching, simplified parallel computing, encrypting and decrypting data using a safe workflow, general moving window statistical estimation, and assistance in interpreting principal component analysis.
Maintained by Frank E Harrell Jr. Last updated 6 days ago.
209 stars 17.64 score 17k scripts 750 dependentsr-lib
usethis:Automate Package and Project Setup
Automate package and project setup tasks that are otherwise performed manually. This includes setting up unit testing, test coverage, continuous integration, Git, 'GitHub', licenses, 'Rcpp', 'RStudio' projects, and more.
Maintained by Jennifer Bryan. Last updated 26 days ago.
869 stars 17.54 score 5.6k scripts 336 dependentsrstudio
bookdown:Authoring Books and Technical Documents with R Markdown
Output formats and utilities for authoring books and technical documents with R Markdown.
Maintained by Yihui Xie. Last updated 17 days ago.
bookbookdownepubgitbookhtmllatexrmarkdown
3.9k stars 17.51 score 1.7k scripts 136 dependentsdmurdoch
rgl:3D Visualization Using OpenGL
Provides medium to high level functions for 3D interactive graphics, including functions modelled on base graphics (plot3d(), etc.) as well as functions for constructing representations of geometric objects (cube3d(), etc.). Output may be on screen using OpenGL, or to various standard 3D file formats including WebGL, PLY, OBJ, STL as well as 2D image formats, including PNG, Postscript, SVG, PGF.
Maintained by Duncan Murdoch. Last updated 3 days ago.
graphicsopenglrglwebgllibglulibglvndlibpnglibx11freetypecpp
91 stars 17.40 score 7.3k scripts 303 dependentsdaattali
shinyjs:Easily Improve the User Experience of Your Shiny Apps in Seconds
Perform common useful JavaScript operations in Shiny apps that will greatly improve your apps without having to know any JavaScript. Examples include: hiding an element, disabling an input, resetting an input back to its original value, delaying code execution by a few seconds, and many more useful functions for both the end user and the developer. 'shinyjs' can also be used to easily call your own custom JavaScript functions from R.
Maintained by Dean Attali. Last updated 8 months ago.
740 stars 17.28 score 8.9k scripts 400 dependentsrstudio
leaflet:Create Interactive Web Maps with the JavaScript 'Leaflet' Library
Create and customize interactive maps using the 'Leaflet' JavaScript library and the 'htmlwidgets' package. These maps can be used directly from the R console, from 'RStudio', in Shiny applications and R Markdown documents.
Maintained by Joe Cheng. Last updated 28 days ago.
821 stars 17.20 score 39k scripts 178 dependentsdavidgohel
flextable:Functions for Tabular Reporting
Use a grammar for creating and customizing pretty tables. The following formats are supported: 'HTML', 'PDF', 'RTF', 'Microsoft Word', 'Microsoft PowerPoint' and R 'Grid Graphics'. 'R Markdown', 'Quarto' and the package 'officer' can be used to produce the result files. The syntax is the same for the user regardless of the type of output to be produced. A set of functions allows the creation, definition of cell arrangement, addition of headers or footers, formatting and definition of cell content with text and or images. The package also offers a set of high-level functions that allow tabular reporting of statistical models and the creation of complex cross tabulations.
Maintained by David Gohel. Last updated 8 days ago.
docxhtml5ms-office-documentsrmarkdowntable
582 stars 17.09 score 7.3k scripts 124 dependentsdreamrs
shinyWidgets:Custom Inputs Widgets for Shiny
Collection of custom input controls and user interface components for 'Shiny' applications. Give your applications a unique and colorful style !
Maintained by Victor Perrier. Last updated 26 days ago.
849 stars 17.05 score 8.1k scripts 218 dependentsbioc
clusterProfiler:A universal enrichment tool for interpreting omics data
This package supports functional characteristics of both coding and non-coding genomics data for thousands of species with up-to-date gene annotation. It provides a univeral interface for gene functional annotation from a variety of sources and thus can be applied in diverse scenarios. It provides a tidy interface to access, manipulate, and visualize enrichment results to help users achieve efficient data interpretation. Datasets obtained from multiple treatments and time points can be analyzed and compared in a single run, easily revealing functional consensus and differences among distinct conditions.
Maintained by Guangchuang Yu. Last updated 4 months ago.
annotationclusteringgenesetenrichmentgokeggmultiplecomparisonpathwaysreactomevisualizationenrichment-analysisgsea
1.1k stars 17.03 score 11k scripts 48 dependentsddsjoberg
gtsummary:Presentation-Ready Data Summary and Analytic Result Tables
Creates presentation-ready tables summarizing data sets, regression models, and more. The code to create the tables is concise and highly customizable. Data frames can be summarized with any function, e.g. mean(), median(), even user-written functions. Regression models are summarized and include the reference rows for categorical variables. Common regression models, such as logistic regression and Cox proportional hazards regression, are automatically identified and the tables are pre-filled with appropriate column headers.
Maintained by Daniel D. Sjoberg. Last updated 6 days ago.
easy-to-usegthtml5regression-modelsreproducibilityreproducible-researchstatisticssummary-statisticssummary-tablestable1tableone
1.1k stars 17.02 score 8.2k scripts 15 dependentssatijalab
Seurat:Tools for Single Cell Genomics
A toolkit for quality control, analysis, and exploration of single cell RNA sequencing data. 'Seurat' aims to enable users to identify and interpret sources of heterogeneity from single cell transcriptomic measurements, and to integrate diverse types of single cell data. See Satija R, Farrell J, Gennert D, et al (2015) <doi:10.1038/nbt.3192>, Macosko E, Basu A, Satija R, et al (2015) <doi:10.1016/j.cell.2015.05.002>, Stuart T, Butler A, et al (2019) <doi:10.1016/j.cell.2019.05.031>, and Hao, Hao, et al (2020) <doi:10.1101/2020.10.12.335331> for more details.
Maintained by Paul Hoffman. Last updated 1 years ago.
human-cell-atlassingle-cell-genomicssingle-cell-rna-seqcpp
2.4k stars 16.86 score 50k scripts 73 dependentsbioc
ggtree:an R package for visualization of tree and annotation data
'ggtree' extends the 'ggplot2' plotting system which implemented the grammar of graphics. 'ggtree' is designed for visualization and annotation of phylogenetic trees and other tree-like structures with their annotation data.
Maintained by Guangchuang Yu. Last updated 5 months ago.
alignmentannotationclusteringdataimportmultiplesequencealignmentphylogeneticsreproducibleresearchsoftwarevisualizationannotationsggplot2phylogenetic-trees
871 stars 16.83 score 5.1k scripts 109 dependentsr-tmap
tmap:Thematic Maps
Thematic maps are geographical maps in which spatial data distributions are visualized. This package offers a flexible, layer-based, and easy to use approach to create thematic maps, such as choropleths and bubble maps.
Maintained by Martijn Tennekes. Last updated 3 days ago.
choropleth-mapsmapsspatialthematic-mapsvisualisation
879 stars 16.25 score 13k scripts 24 dependentsbioc
enrichplot:Visualization of Functional Enrichment Result
The 'enrichplot' package implements several visualization methods for interpreting functional enrichment results obtained from ORA or GSEA analysis. It is mainly designed to work with the 'clusterProfiler' package suite. All the visualization methods are developed based on 'ggplot2' graphics.
Maintained by Guangchuang Yu. Last updated 3 months ago.
annotationgenesetenrichmentgokeggpathwayssoftwarevisualizationenrichment-analysispathway-analysis
239 stars 15.71 score 3.1k scripts 58 dependentsstan-dev
rstanarm:Bayesian Applied Regression Modeling via Stan
Estimates previously compiled regression models using the 'rstan' package, which provides the R interface to the Stan C++ library for Bayesian estimation. Users specify models via the customary R syntax with a formula and data.frame plus some additional arguments for priors.
Maintained by Ben Goodrich. Last updated 12 days ago.
bayesianbayesian-data-analysisbayesian-inferencebayesian-methodsbayesian-statisticsmultilevel-modelsrstanrstanarmstanstatistical-modelingcpp
393 stars 15.70 score 5.0k scripts 13 dependentsr-lib
profvis:Interactive Visualizations for Profiling R Code
Interactive visualizations for profiling R code.
Maintained by Hadley Wickham. Last updated 6 months ago.
310 stars 15.64 score 1.3k scripts 153 dependentsprophet:Automatic Forecasting Procedure
Implements a procedure for forecasting time series data based on an additive model where non-linear trends are fit with yearly, weekly, and daily seasonality, plus holiday effects. It works best with time series that have strong seasonal effects and several seasons of historical data. Prophet is robust to missing data and shifts in the trend, and typically handles outliers well.
Maintained by Sean Taylor. Last updated 5 months ago.
19k stars 15.59 score 976 scripts 13 dependentstidyverse
reprex:Prepare Reproducible Example Code via the Clipboard
Convenience wrapper that uses the 'rmarkdown' package to render small snippets of code to target formats that include both code and output. The goal is to encourage the sharing of small, reproducible, and runnable examples on code-oriented websites, such as <https://stackoverflow.com> and <https://github.com>, or in email. The user's clipboard is the default source of input code and the default target for rendered output. 'reprex' also extracts clean, runnable R code from various common formats, such as copy/paste from an R session.
Maintained by Jennifer Bryan. Last updated 7 months ago.
githubreproducibilityrmarkdownstackoverflow
744 stars 15.58 score 498 scripts 127 dependentsrstudio
shinydashboard:Create Dashboards with 'Shiny'
Create dashboards with 'Shiny'. This package provides a theme on top of 'Shiny', making it easy to create attractive dashboards.
Maintained by Winston Chang. Last updated 3 years ago.
admin-dashboarddashboardreactivityrstudioshinyshinydashboardweb-appweb-development
909 stars 15.37 score 17k scripts 212 dependentsgforge
htmlTable:Advanced Tables for Markdown/HTML
Tables with state-of-the-art layout elements such as row spanners, column spanners, table spanners, zebra striping, and more. While allowing advanced layout, the underlying css-structure is simple in order to maximize compatibility with common word processors. The package also contains a few text formatting functions that help outputting text compatible with HTML/LaTeX.
Maintained by Max Gordon. Last updated 8 months ago.
79 stars 15.33 score 1.3k scripts 767 dependentsrstudio
sass:Syntactically Awesome Style Sheets ('Sass')
An 'SCSS' compiler, powered by the 'LibSass' library. With this, R developers can use variables, inheritance, and functions to generate dynamic style sheets. The package uses the 'Sass CSS' extension language, which is stable, powerful, and CSS compatible.
Maintained by Carson Sievert. Last updated 11 months ago.
100 stars 15.30 score 252 scripts 4.3k dependentsrich-iannone
DiagrammeR:Graph/Network Visualization
Build graph/network structures using functions for stepwise addition and deletion of nodes and edges. Work with data available in tables for bulk addition of nodes, edges, and associated metadata. Use graph selections and traversals to apply changes to specific nodes or edges. A wide selection of graph algorithms allow for the analysis of graphs. Visualize the graphs and take advantage of any aesthetic properties assigned to nodes and edges.
Maintained by Richard Iannone. Last updated 2 months ago.
graphgraph-functionsnetwork-graphproperty-graphvisualization
1.7k stars 15.29 score 3.8k scripts 86 dependentsdatastorm-open
visNetwork:Network Visualization using 'vis.js' Library
Provides an R interface to the 'vis.js' JavaScript charting library. It allows an interactive visualization of networks.
Maintained by Benoit Thieurmel. Last updated 2 years ago.
550 stars 15.25 score 4.1k scripts 196 dependentsquarto-dev
quarto:R Interface to 'Quarto' Markdown Publishing System
Convert R Markdown documents and 'Jupyter' notebooks to a variety of output formats using 'Quarto'.
Maintained by Christophe Dervieux. Last updated 14 days ago.
147 stars 14.98 score 1.3k scripts 36 dependentsbioc
DOSE:Disease Ontology Semantic and Enrichment analysis
This package implements five methods proposed by Resnik, Schlicker, Jiang, Lin and Wang respectively for measuring semantic similarities among DO terms and gene products. Enrichment analyses including hypergeometric model and gene set enrichment analysis are also implemented for discovering disease associations of high-throughput biological data.
Maintained by Guangchuang Yu. Last updated 5 months ago.
annotationvisualizationmultiplecomparisongenesetenrichmentpathwayssoftwaredisease-ontologyenrichment-analysissemantic-similarity
119 stars 14.97 score 2.0k scripts 61 dependentstidyverse
googledrive:An Interface to Google Drive
Manage Google Drive files from R.
Maintained by Jennifer Bryan. Last updated 8 months ago.
329 stars 14.97 score 2.1k scripts 164 dependentsphilchalmers
mirt:Multidimensional Item Response Theory
Analysis of discrete response data using unidimensional and multidimensional item analysis models under the Item Response Theory paradigm (Chalmers (2012) <doi:10.18637/jss.v048.i06>). Exploratory and confirmatory item factor analysis models are estimated with quadrature (EM) or stochastic (MHRM) methods. Confirmatory bi-factor and two-tier models are available for modeling item testlets using dimension reduction EM algorithms, while multiple group analyses and mixed effects designs are included for detecting differential item, bundle, and test functioning, and for modeling item and person covariates. Finally, latent class models such as the DINA, DINO, multidimensional latent class, mixture IRT models, and zero-inflated response models are supported, as well as a wide family of probabilistic unfolding models.
Maintained by Phil Chalmers. Last updated 4 days ago.
212 stars 14.93 score 2.5k scripts 40 dependentsr-lib
gargle:Utilities for Working with Google APIs
Provides utilities for working with Google APIs <https://developers.google.com/apis-explorer>. This includes functions and classes for handling common credential types and for preparing, executing, and processing HTTP requests.
Maintained by Jennifer Bryan. Last updated 2 years ago.
113 stars 14.90 score 266 scripts 192 dependentsrstudio
learnr:Interactive Tutorials for R
Create interactive tutorials using R Markdown. Use a combination of narrative, figures, videos, exercises, and quizzes to create self-paced tutorials for learning about R and R packages.
Maintained by Garrick Aden-Buie. Last updated 7 months ago.
interactivepythonrmarkdownshinysqlteachingtutorial
713 stars 14.79 score 6.5k scripts 27 dependentsflorianhartig
DHARMa:Residual Diagnostics for Hierarchical (Multi-Level / Mixed) Regression Models
The 'DHARMa' package uses a simulation-based approach to create readily interpretable scaled (quantile) residuals for fitted (generalized) linear mixed models. Currently supported are linear and generalized linear (mixed) models from 'lme4' (classes 'lmerMod', 'glmerMod'), 'glmmTMB', 'GLMMadaptive', and 'spaMM'; phylogenetic linear models from 'phylolm' (classes 'phylolm' and 'phyloglm'); generalized additive models ('gam' from 'mgcv'); 'glm' (including 'negbin' from 'MASS', but excluding quasi-distributions) and 'lm' model classes. Moreover, externally created simulations, e.g. posterior predictive simulations from Bayesian software such as 'JAGS', 'STAN', or 'BUGS' can be processed as well. The resulting residuals are standardized to values between 0 and 1 and can be interpreted as intuitively as residuals from a linear regression. The package also provides a number of plot and test functions for typical model misspecification problems, such as over/underdispersion, zero-inflation, and residual spatial, phylogenetic and temporal autocorrelation.
Maintained by Florian Hartig. Last updated 27 days ago.
glmmregressionregression-diagnosticsresidual
226 stars 14.74 score 2.8k scripts 10 dependentshusson
FactoMineR:Multivariate Exploratory Data Analysis and Data Mining
Exploratory data analysis methods to summarize, visualize and describe datasets. The main principal component methods are available, those with the largest potential in terms of applications: principal component analysis (PCA) when variables are quantitative, correspondence analysis (CA) and multiple correspondence analysis (MCA) when variables are categorical, Multiple Factor Analysis when variables are structured in groups, etc. and hierarchical cluster analysis. F. Husson, S. Le and J. Pages (2017).
Maintained by Francois Husson. Last updated 4 months ago.
47 stars 14.71 score 5.6k scripts 112 dependentsglin
reactable:Interactive Data Tables for R
Interactive data tables for R, based on the 'React Table' JavaScript library. Provides an HTML widget that can be used in 'R Markdown' or 'Quarto' documents, 'Shiny' applications, or viewed from an R console.
Maintained by Greg Lin. Last updated 2 months ago.
648 stars 14.57 score 3.3k scripts 158 dependentstidyverse
googlesheets4:Access Google Sheets using the Sheets API V4
Interact with Google Sheets through the Sheets API v4 <https://developers.google.com/sheets/api>. "API" is an acronym for "application programming interface"; the Sheets API allows users to interact with Google Sheets programmatically, instead of via a web browser. The "v4" refers to the fact that the Sheets API is currently at version 4. This package can read and write both the metadata and the cell data in a Sheet.
Maintained by Jennifer Bryan. Last updated 8 months ago.
google-drivegoogle-sheetsspreadsheet
363 stars 14.55 score 7.0k scripts 142 dependentsr-lidar
lidR:Airborne LiDAR Data Manipulation and Visualization for Forestry Applications
Airborne LiDAR (Light Detection and Ranging) interface for data manipulation and visualization. Read/write 'las' and 'laz' files, computation of metrics in area based approach, point filtering, artificial point reduction, classification from geographic data, normalization, individual tree segmentation and other manipulations.
Maintained by Jean-Romain Roussel. Last updated 2 months ago.
alsforestrylaslazlidarpoint-cloudremote-sensingopenblascppopenmp
623 stars 14.47 score 844 scripts 8 dependentsr-spatial
mapview:Interactive Viewing of Spatial Data in R
Quickly and conveniently create interactive visualisations of spatial data with or without background maps. Attributes of displayed features are fully queryable via pop-up windows. Additional functionality includes methods to visualise true- and false-color raster images and bounding boxes.
Maintained by Tim Appelhans. Last updated 3 months ago.
gisleafletmapsspatialvisualizationweb-mapping
526 stars 14.39 score 7.3k scripts 27 dependentsdavidgohel
ggiraph:Make 'ggplot2' Graphics Interactive
Create interactive 'ggplot2' graphics using 'htmlwidgets'.
Maintained by David Gohel. Last updated 3 days ago.
822 stars 14.37 score 4.1k scripts 35 dependentsbioc
xcms:LC-MS and GC-MS Data Analysis
Framework for processing and visualization of chromatographically separated and single-spectra mass spectral data. Imports from AIA/ANDI NetCDF, mzXML, mzData and mzML files. Preprocesses data for high-throughput, untargeted analyte profiling.
Maintained by Steffen Neumann. Last updated 17 days ago.
immunooncologymassspectrometrymetabolomicsbioconductorfeature-detectionmass-spectrometrypeak-detectioncpp
196 stars 14.31 score 984 scripts 11 dependentstalgalili
heatmaply:Interactive Cluster Heat Maps Using 'plotly' and 'ggplot2'
Create interactive cluster 'heatmaps' that can be saved as a stand- alone HTML file, embedded in 'R Markdown' documents or in a 'Shiny' app, and available in the 'RStudio' viewer pane. Hover the mouse pointer over a cell to show details or drag a rectangle to zoom. A 'heatmap' is a popular graphical method for visualizing high-dimensional data, in which a table of numbers are encoded as a grid of colored cells. The rows and columns of the matrix are ordered to highlight patterns and are often accompanied by 'dendrograms'. 'Heatmaps' are used in many fields for visualizing observations, correlations, missing values patterns, and more. Interactive 'heatmaps' allow the inspection of specific value by hovering the mouse over a cell, as well as zooming into a region of the 'heatmap' by dragging a rectangle around the relevant area. This work is based on the 'ggplot2' and 'plotly.js' engine. It produces similar 'heatmaps' to 'heatmap.2' with the advantage of speed ('plotly.js' is able to handle larger size matrix), the ability to zoom from the 'dendrogram' panes, and the placing of factor variables in the sides of the 'heatmap'.
Maintained by Tal Galili. Last updated 9 months ago.
d3-heatmapdendextenddendrogramggplot2heatmapplotly
386 stars 14.21 score 2.0k scripts 45 dependentsthinkr-open
golem:A Framework for Robust Shiny Applications
An opinionated framework for building a production-ready 'Shiny' application. This package contains a series of tools for building a robust 'Shiny' application from start to finish.
Maintained by Colin Fay. Last updated 7 months ago.
golemversehacktoberfestshinyshiny-appsshiny-rshinyapps
921 stars 14.21 score 167 scripts 63 dependentsr-lib
pkgload:Simulate Package Installation and Attach
Simulates the process of installing a package and then attaching it. This is a key part of the 'devtools' package as it allows you to rapidly iterate while developing a package.
Maintained by Lionel Henry. Last updated 6 days ago.
59 stars 14.21 score 112 scripts 590 dependentsbusiness-science
timetk:A Tool Kit for Working with Time Series
Easy visualization, wrangling, and feature engineering of time series data for forecasting and machine learning prediction. Consolidates and extends time series functionality from packages including 'dplyr', 'stats', 'xts', 'forecast', 'slider', 'padr', 'recipes', and 'rsample'.
Maintained by Matt Dancho. Last updated 1 years ago.
coercioncoercion-functionsdata-miningdplyrforecastforecastingforecasting-modelsmachine-learningseries-decompositionseries-signaturetibbletidytidyquanttidyversetimetime-seriestimeseries
626 stars 14.20 score 4.0k scripts 16 dependentsrstudio
pins:Pin, Discover, and Share Resources
Publish data sets, models, and other R objects, making it easy to share them across projects and with your colleagues. You can pin objects to a variety of "boards", including local folders (to share on a networked drive or with 'DropBox'), 'Posit Connect', 'AWS S3', and more.
Maintained by Julia Silge. Last updated 2 months ago.
azuregcloudrpinsrsconnects3storage
321 stars 14.17 score 1.9k scripts 17 dependentskassambara
factoextra:Extract and Visualize the Results of Multivariate Data Analyses
Provides some easy-to-use functions to extract and visualize the output of multivariate data analyses, including 'PCA' (Principal Component Analysis), 'CA' (Correspondence Analysis), 'MCA' (Multiple Correspondence Analysis), 'FAMD' (Factor Analysis of Mixed Data), 'MFA' (Multiple Factor Analysis) and 'HMFA' (Hierarchical Multiple Factor Analysis) functions from different R packages. It contains also functions for simplifying some clustering analysis steps and provides 'ggplot2' - based elegant data visualization.
Maintained by Alboukadel Kassambara. Last updated 5 years ago.
363 stars 14.13 score 15k scripts 52 dependentsbioc
GOSemSim:GO-terms Semantic Similarity Measures
The semantic comparisons of Gene Ontology (GO) annotations provide quantitative ways to compute similarities between genes and gene groups, and have became important basis for many bioinformatics analysis approaches. GOSemSim is an R package for semantic similarity computation among GO terms, sets of GO terms, gene products and gene clusters. GOSemSim implemented five methods proposed by Resnik, Schlicker, Jiang, Lin and Wang respectively.
Maintained by Guangchuang Yu. Last updated 5 months ago.
annotationgoclusteringpathwaysnetworksoftwarebioinformaticsgene-ontologysemantic-similaritycpp
63 stars 14.12 score 708 scripts 68 dependentsjbkunst
highcharter:A Wrapper for the 'Highcharts' Library
A wrapper for the 'Highcharts' library including shortcut functions to plot R objects. 'Highcharts' <https://www.highcharts.com/> is a charting library offering numerous chart types with a simple configuration syntax.
Maintained by Joshua Kunst. Last updated 1 years ago.
highchartshtmlwidgetsshinyshiny-rvisualizationwrapper
725 stars 13.93 score 4.9k scripts 18 dependentsdaattali
shinycssloaders:Add Loading Animations to a 'shiny' Output While It's Recalculating
When a 'Shiny' output (such as a plot, table, map, etc.) is recalculating, it remains visible but gets greyed out. Using 'shinycssloaders', you can add a loading animation ("spinner") to outputs instead. By wrapping a 'Shiny' output in 'withSpinner()', a spinner will automatically appear while the output is recalculating. You can also manually show and hide the spinner, or add a full-page spinner to cover the entire page. See the demo online at <https://daattali.com/shiny/shinycssloaders-demo/>.
Maintained by Dean Attali. Last updated 13 days ago.
410 stars 13.92 score 4.3k scripts 120 dependentsrinterface
shinydashboardPlus:Add More 'AdminLTE2' Components to 'shinydashboard'
Extend 'shinydashboard' with 'AdminLTE2' components. 'AdminLTE2' is a free 'Bootstrap 3' dashboard template available at <https://adminlte.io>. Customize boxes, add timelines and a lot more.
Maintained by David Granjon. Last updated 8 months ago.
dashboardhacktoberfest2022shinyshiny-appsshinydashboard
461 stars 13.82 score 1.1k scripts 28 dependentsr-spatial
rgee:R Bindings for Calling the 'Earth Engine' API
Earth Engine <https://earthengine.google.com/> client library for R. All of the 'Earth Engine' API classes, modules, and functions are made available. Additional functions implemented include importing (exporting) of Earth Engine spatial objects, extraction of time series, interactive map display, assets management interface, and metadata display. See <https://r-spatial.github.io/rgee/> for further details.
Maintained by Cesar Aybar. Last updated 4 days ago.
earth-engineearthenginegoogle-earth-enginegoogleearthenginespatial-analysisspatial-data
717 stars 13.77 score 1.9k scripts 3 dependentsbioc
mixOmics:Omics Data Integration Project
Multivariate methods are well suited to large omics data sets where the number of variables (e.g. genes, proteins, metabolites) is much larger than the number of samples (patients, cells, mice). They have the appealing properties of reducing the dimension of the data by using instrumental variables (components), which are defined as combinations of all variables. Those components are then used to produce useful graphical outputs that enable better understanding of the relationships and correlation structures between the different data sets that are integrated. mixOmics offers a wide range of multivariate methods for the exploration and integration of biological datasets with a particular focus on variable selection. The package proposes several sparse multivariate models we have developed to identify the key variables that are highly correlated, and/or explain the biological outcome of interest. The data that can be analysed with mixOmics may come from high throughput sequencing technologies, such as omics data (transcriptomics, metabolomics, proteomics, metagenomics etc) but also beyond the realm of omics (e.g. spectral imaging). The methods implemented in mixOmics can also handle missing values without having to delete entire rows with missing data. A non exhaustive list of methods include variants of generalised Canonical Correlation Analysis, sparse Partial Least Squares and sparse Discriminant Analysis. Recently we implemented integrative methods to combine multiple data sets: N-integration with variants of Generalised Canonical Correlation Analysis and P-integration with variants of multi-group Partial Least Squares.
Maintained by Eva Hamrud. Last updated 3 days ago.
immunooncologymicroarraysequencingmetabolomicsmetagenomicsproteomicsgenepredictionmultiplecomparisonclassificationregressionbioconductorgenomicsgenomics-datagenomics-visualizationmultivariate-analysismultivariate-statisticsomicsr-pkgr-project
185 stars 13.75 score 1.3k scripts 22 dependentsropensci
taxize:Taxonomic Information from Around the Web
Interacts with a suite of web application programming interfaces (API) for taxonomic tasks, such as getting database specific taxonomic identifiers, verifying species names, getting taxonomic hierarchies, fetching downstream and upstream taxonomic names, getting taxonomic synonyms, converting scientific to common names and vice versa, and more. Some of the services supported include 'NCBI E-utilities' (<https://www.ncbi.nlm.nih.gov/books/NBK25501/>), 'Encyclopedia of Life' (<https://eol.org/docs/what-is-eol/data-services>), 'Global Biodiversity Information Facility' (<https://techdocs.gbif.org/en/openapi/>), and many more. Links to the API documentation for other supported services are available in the documentation for their respective functions in this package.
Maintained by Zachary Foster. Last updated 27 days ago.
taxonomybiologynomenclaturejsonapiwebapi-clientidentifiersspeciesnamesapi-wrapperbiodiversitydarwincoredatataxize
274 stars 13.63 score 1.6k scripts 23 dependentschristophergandrud
networkD3:D3 JavaScript Network Graphs from R
Creates 'D3' 'JavaScript' network, tree, dendrogram, and Sankey graphs from 'R'.
Maintained by Christopher Gandrud. Last updated 6 years ago.
654 stars 13.60 score 3.4k scripts 31 dependentsyulab-smu
scatterpie:Scatter Pie Plot
Creates scatterpie plots, especially useful for plotting pies on a map.
Maintained by Guangchuang Yu. Last updated 3 months ago.
62 stars 13.60 score 820 scripts 68 dependentsrstudio
dygraphs:Interface to 'Dygraphs' Interactive Time Series Charting Library
An R interface to the 'dygraphs' JavaScript charting library (a copy of which is included in the package). Provides rich facilities for charting time-series data in R, including highly configurable series- and axis-display and interactive features like zoom/pan and series/point highlighting.
Maintained by Petr Shevtsov. Last updated 2 years ago.
365 stars 13.48 score 3.6k scripts 65 dependentsbioc
RCy3:Functions to Access and Control Cytoscape
Vizualize, analyze and explore networks using Cytoscape via R. Anything you can do using the graphical user interface of Cytoscape, you can now do with a single RCy3 function.
Maintained by Alex Pico. Last updated 5 days ago.
visualizationgraphandnetworkthirdpartyclientnetwork
52 stars 13.47 score 628 scripts 17 dependentsdaattali
ggExtra:Add Marginal Histograms to 'ggplot2', and More 'ggplot2' Enhancements
Collection of functions and layers to enhance 'ggplot2'. The flagship function is 'ggMarginal()', which can be used to add marginal histograms/boxplots/density plots to 'ggplot2' scatterplots.
Maintained by Dean Attali. Last updated 10 months ago.
ggplot2ggplot2-enhancementsmarginal-plots
387 stars 13.45 score 3.3k scripts 28 dependentsphilchalmers
SimDesign:Structure for Organizing Monte Carlo Simulation Designs
Provides tools to safely and efficiently organize and execute Monte Carlo simulation experiments in R. The package controls the structure and back-end of Monte Carlo simulation experiments by utilizing a generate-analyse-summarise workflow. The workflow safeguards against common simulation coding issues, such as automatically re-simulating non-convergent results, prevents inadvertently overwriting simulation files, catches error and warning messages during execution, implicitly supports parallel processing with high-quality random number generation, and provides tools for managing high-performance computing (HPC) array jobs submitted to schedulers such as SLURM. For a pedagogical introduction to the package see Sigal and Chalmers (2016) <doi:10.1080/10691898.2016.1246953>. For a more in-depth overview of the package and its design philosophy see Chalmers and Adkins (2020) <doi:10.20982/tqmp.16.4.p248>.
Maintained by Phil Chalmers. Last updated 3 days ago.
monte-carlo-simulationsimulationsimulation-framework
62 stars 13.41 score 253 scripts 47 dependentsyulab-smu
tidytree:A Tidy Tool for Phylogenetic Tree Data Manipulation
Phylogenetic tree generally contains multiple components including node, edge, branch and associated data. 'tidytree' provides an approach to convert tree object to tidy data frame as well as provides tidy interfaces to manipulate tree data.
Maintained by Guangchuang Yu. Last updated 8 months ago.
phylogenetic-treetidyversetree-data
56 stars 13.36 score 584 scripts 128 dependentsbusiness-science
tidyquant:Tidy Quantitative Financial Analysis
Bringing business and financial analysis to the 'tidyverse'. The 'tidyquant' package provides a convenient wrapper to various 'xts', 'zoo', 'quantmod', 'TTR' and 'PerformanceAnalytics' package functions and returns the objects in the tidy 'tibble' format. The main advantage is being able to use quantitative functions with the 'tidyverse' functions including 'purrr', 'dplyr', 'tidyr', 'ggplot2', 'lubridate', etc. See the 'tidyquant' website for more information, documentation and examples.
Maintained by Matt Dancho. Last updated 2 months ago.
dplyrfinancial-analysisfinancial-datafinancial-statementsmultiple-stocksperformance-analysisperformanceanalyticsquantmodstockstock-exchangesstock-indexesstock-listsstock-performancestock-pricesstock-symboltidyversetime-seriestimeseriesxts
872 stars 13.34 score 5.2k scriptsdreamrs
esquisse:Explore and Visualize Your Data Interactively
A 'shiny' gadget to create 'ggplot2' figures interactively with drag-and-drop to map your variables to different aesthetics. You can quickly visualize your data accordingly to their type, export in various formats, and retrieve the code to reproduce the plot.
Maintained by Victor Perrier. Last updated 1 months ago.
addindata-visualizationggplot2rstudio-addinvisualization
1.8k stars 13.31 score 1.1k scripts 1 dependentstrafficonese
leaflet.extras:Extra Functionality for 'leaflet' Package
The 'leaflet' JavaScript library provides many plugins some of which are available in the core 'leaflet' package, but there are many more. It is not possible to support them all in the core 'leaflet' package. This package serves as an add-on to the 'leaflet' package by providing extra functionality via 'leaflet' plugins.
Maintained by Sebastian Gatscha. Last updated 3 months ago.
data-visualizationgeospatialleaflet
218 stars 13.27 score 2.5k scripts 25 dependentsguangchuangyu
ggplotify:Convert Plot to 'grob' or 'ggplot' Object
Convert plot function call (using expression or formula) to 'grob' or 'ggplot' object that compatible to the 'grid' and 'ggplot2' ecosystem. With this package, we are able to e.g. using 'cowplot' to align plots produced by 'base' graphics, 'ComplexHeatmap', 'eulerr', 'grid', 'lattice', 'magick', 'pheatmap', 'vcd' etc. by converting them to 'ggplot' objects.
Maintained by Guangchuang Yu. Last updated 1 years ago.
baseplotggplot2gridlatticeupsetrvcd
108 stars 13.23 score 2.0k scripts 174 dependentsrstudio
shinythemes:Themes for Shiny
Themes for use with Shiny. Includes several Bootstrap themes from <https://bootswatch.com/>, which are packaged for use with Shiny applications.
Maintained by Winston Chang. Last updated 3 years ago.
155 stars 13.20 score 8.5k scripts 125 dependentswadpac
GGIR:Raw Accelerometer Data Analysis
A tool to process and analyse data collected with wearable raw acceleration sensors as described in Migueles and colleagues (JMPB 2019), and van Hees and colleagues (JApplPhysiol 2014; PLoSONE 2015). The package has been developed and tested for binary data from 'GENEActiv' <https://activinsights.com/>, binary (.gt3x) and .csv-export data from 'Actigraph' <https://theactigraph.com> devices, and binary (.cwa) and .csv-export data from 'Axivity' <https://axivity.com>. These devices are currently widely used in research on human daily physical activity. Further, the package can handle accelerometer data file from any other sensor brand providing that the data is stored in csv format. Also the package allows for external function embedding.
Maintained by Vincent T van Hees. Last updated 17 days ago.
accelerometeractivity-recognitioncircadian-rhythmmovement-sensorsleep
109 stars 13.20 score 342 scripts 3 dependentsstan-dev
shinystan:Interactive Visual and Numerical Diagnostics and Posterior Analysis for Bayesian Models
A graphical user interface for interactive Markov chain Monte Carlo (MCMC) diagnostics and plots and tables helpful for analyzing a posterior sample. The interface is powered by the 'Shiny' web application framework from 'RStudio' and works with the output of MCMC programs written in any programming language (and has extended functionality for 'Stan' models fit using the 'rstan' and 'rstanarm' packages).
Maintained by Jonah Gabry. Last updated 3 years ago.
bayesianbayesian-data-analysisbayesian-inferencebayesian-methodsbayesian-statisticsmcmcshiny-appsstanstatistical-graphics
200 stars 13.13 score 1.6k scripts 15 dependentslchiffon
wordcloud2:Create Word Cloud by htmlWidget
A fast visualization tool for creating wordcloud by using wordcloud2.js.
Maintained by Dawei Lang. Last updated 7 years ago.
402 stars 13.10 score 2.8k scripts 11 dependentskeaven
gsDesign:Group Sequential Design
Derives group sequential clinical trial designs and describes their properties. Particular focus on time-to-event, binary, and continuous outcomes. Largely based on methods described in Jennison, Christopher and Turnbull, Bruce W., 2000, "Group Sequential Methods with Applications to Clinical Trials" ISBN: 0-8493-0316-8.
Maintained by Keaven Anderson. Last updated 27 days ago.
biostatisticsboundariesclinical-trialsdesignspending-functions
51 stars 13.05 score 338 scripts 5 dependentsbioc
Gviz:Plotting data and annotation information along genomic coordinates
Genomic data analyses requires integrated visualization of known genomic information and new experimental data. Gviz uses the biomaRt and the rtracklayer packages to perform live annotation queries to Ensembl and UCSC and translates this to e.g. gene/transcript structures in viewports of the grid graphics package. This results in genomic information plotted together with your data.
Maintained by Robert Ivanek. Last updated 5 months ago.
visualizationmicroarraysequencing
79 stars 13.05 score 1.4k scripts 46 dependentsbioc
ChIPseeker:ChIPseeker for ChIP peak Annotation, Comparison, and Visualization
This package implements functions to retrieve the nearest genes around the peak, annotate genomic region of the peak, statstical methods for estimate the significance of overlap among ChIP peak data sets, and incorporate GEO database for user to compare the own dataset with those deposited in database. The comparison can be used to infer cooperative regulation and thus can be used to generate hypotheses. Several visualization functions are implemented to summarize the coverage of the peak experiment, average profile and heatmap of peaks binding to TSS regions, genomic annotation, distance to TSS, and overlap of peaks or genes.
Maintained by Guangchuang Yu. Last updated 5 months ago.
annotationchipseqsoftwarevisualizationmultiplecomparisonatac-seqchip-seqcomparisonepigeneticsepigenomics
233 stars 13.05 score 1.6k scripts 5 dependentsbioc
Spectra:Spectra Infrastructure for Mass Spectrometry Data
The Spectra package defines an efficient infrastructure for storing and handling mass spectrometry spectra and functionality to subset, process, visualize and compare spectra data. It provides different implementations (backends) to store mass spectrometry data. These comprise backends tuned for fast data access and processing and backends for very large data sets ensuring a small memory footprint.
Maintained by RforMassSpectrometry Package Maintainer. Last updated 24 days ago.
infrastructureproteomicsmassspectrometrymetabolomicsbioconductorhacktoberfestmass-spectrometry
41 stars 13.01 score 254 scripts 35 dependentsappsilon
shiny.semantic:Semantic UI Support for Shiny
Creating a great user interface for your Shiny apps can be a hassle, especially if you want to work purely in R and don't want to use, for instance HTML templates. This package adds support for a powerful UI library Fomantic UI - <https://fomantic-ui.com/> (before Semantic). It also supports universal UI input binding that works with various DOM elements.
Maintained by Jakub Nowicki. Last updated 12 months ago.
appsilonfomantic-uirhinoversesemanticsemantic-componentssemantic-uishiny
506 stars 13.00 score 586 scripts 3 dependentsropensci
piggyback:Managing Larger Data on a GitHub Repository
Helps store files as GitHub release assets, which is a convenient way for large/binary data files to piggyback onto public and private GitHub repositories. Includes functions for file downloads, uploads, and managing releases via the GitHub API.
Maintained by Carl Boettiger. Last updated 4 months ago.
data-storegit-lfspeer-reviewed
187 stars 12.98 score 187 scripts 12 dependentsjuba
questionr:Functions to Make Surveys Processing Easier
Set of functions to make the processing and analysis of surveys easier : interactive shiny apps and addins for data recoding, contingency tables, dataset metadata handling, and several convenience functions.
Maintained by Julien Barnier. Last updated 10 days ago.
83 stars 12.93 score 1.1k scripts 19 dependentsyixuan
prettydoc:Creating Pretty Documents from R Markdown
Creating tiny yet beautiful documents and vignettes from R Markdown. The package provides the 'html_pretty' output format as an alternative to the 'html_document' and 'html_vignette' engines that convert R Markdown into HTML pages. Various themes and syntax highlight styles are supported.
Maintained by Yixuan Qiu. Last updated 4 years ago.
486 stars 12.90 score 550 scripts 8 dependentsfriendly
matlib:Matrix Functions for Teaching and Learning Linear Algebra and Multivariate Statistics
A collection of matrix functions for teaching and learning matrix linear algebra as used in multivariate statistical methods. Many of these functions are designed for tutorial purposes in learning matrix algebra ideas using R. In some cases, functions are provided for concepts available elsewhere in R, but where the function call or name is not obvious. In other cases, functions are provided to show or demonstrate an algorithm. In addition, a collection of functions are provided for drawing vector diagrams in 2D and 3D and for rendering matrix expressions and equations in LaTeX.
Maintained by Michael Friendly. Last updated 16 days ago.
diagramslinear-equationsmatrixmatrix-functionsmatrix-visualizervectorvignette
65 stars 12.89 score 900 scripts 11 dependentsjohncoene
waiter:Loading Screen for 'Shiny'
Full screen and partial loading screens for 'Shiny' with spinners, progress bars, and notifications.
Maintained by John Coene. Last updated 12 months ago.
496 stars 12.87 score 702 scripts 68 dependentsrinterface
bs4Dash:A 'Bootstrap 4' Version of 'shinydashboard'
Make 'Bootstrap 4' Shiny dashboards. Use the full power of 'AdminLTE3', a dashboard template built on top of 'Bootstrap 4' <https://github.com/ColorlibHQ/AdminLTE>.
Maintained by David Granjon. Last updated 7 months ago.
bootstrap4dashboard-templateshacktoberfest2022shinyshiny-appsshinydashboard
442 stars 12.87 score 1.2k scripts 15 dependentsbioc
iSEE:Interactive SummarizedExperiment Explorer
Create an interactive Shiny-based graphical user interface for exploring data stored in SummarizedExperiment objects, including row- and column-level metadata. The interface supports transmission of selections between plots and tables, code tracking, interactive tours, interactive or programmatic initialization, preservation of app state, and extensibility to new panel types via S4 classes. Special attention is given to single-cell data in a SingleCellExperiment object with visualization of dimensionality reduction results.
Maintained by Kevin Rue-Albrecht. Last updated 25 days ago.
cellbasedassaysclusteringdimensionreductionfeatureextractiongeneexpressionguiimmunooncologyshinyappssinglecelltranscriptiontranscriptomicsvisualizationdimension-reductionfeature-extractiongene-expressionhacktoberfesthuman-cell-atlasshinysingle-cell
225 stars 12.86 score 380 scripts 9 dependentsmarkedmondson1234
googleAuthR:Authenticate and Create Google APIs
Create R functions that interact with OAuth2 Google APIs <https://developers.google.com/apis-explorer/> easily, with auto-refresh and Shiny compatibility.
Maintained by Erik Grรถnroos. Last updated 10 months ago.
apiauthenticationgooglegoogleauthroauth2-flowshiny
178 stars 12.85 score 804 scripts 13 dependentsbioc
EBImage:Image processing and analysis toolbox for R
EBImage provides general purpose functionality for image processing and analysis. In the context of (high-throughput) microscopy-based cellular assays, EBImage offers tools to segment cells and extract quantitative cellular descriptors. This allows the automation of such tasks using the R programming language and facilitates the use of other tools in the R environment for signal processing, statistical modeling, machine learning and visualization with image data.
Maintained by Andrzej Oleล. Last updated 5 months ago.
visualizationbioinformaticsimage-analysisimage-processingcpp
71 stars 12.77 score 1.5k scripts 33 dependentsbioc
MSnbase:Base Functions and Classes for Mass Spectrometry and Proteomics
MSnbase provides infrastructure for manipulation, processing and visualisation of mass spectrometry and proteomics data, ranging from raw to quantitative and annotated data.
Maintained by Laurent Gatto. Last updated 17 days ago.
immunooncologyinfrastructureproteomicsmassspectrometryqualitycontroldataimportbioconductorbioinformaticsmass-spectrometryproteomics-datavisualisationcpp
131 stars 12.76 score 772 scripts 36 dependentsyihui
xaringan:Presentation Ninja
Create HTML5 slides with R Markdown and the JavaScript library 'remark.js' (<https://remarkjs.com>).
Maintained by Yihui Xie. Last updated 1 years ago.
markdownnarutoninjapresentationpresentation-ninjaremarkjsrmarkdownrstudioslideshow
1.5k stars 12.69 score 948 scripts 10 dependentsinsightsengineering
teal:Exploratory Web Apps for Analyzing Clinical Trials Data
A 'shiny' based interactive exploration framework for analyzing clinical trials data. 'teal' currently provides a dynamic filtering facility and different data viewers. 'teal' 'shiny' applications are built using standard 'shiny' modules.
Maintained by Dawid Kaledkowski. Last updated 1 months ago.
clinical-trialsnestshinywebapp
206 stars 12.65 score 176 scripts 5 dependentsthibautjombart
adegenet:Exploratory Analysis of Genetic and Genomic Data
Toolset for the exploration of genetic and genomic data. Adegenet provides formal (S4) classes for storing and handling various genetic data, including genetic markers with varying ploidy and hierarchical population structure ('genind' class), alleles counts by populations ('genpop'), and genome-wide SNP data ('genlight'). It also implements original multivariate methods (DAPC, sPCA), graphics, statistical tests, simulation tools, distance and similarity measures, and several spatial methods. A range of both empirical and simulated datasets is also provided to illustrate various methods.
Maintained by Zhian N. Kamvar. Last updated 2 months ago.
182 stars 12.60 score 1.9k scripts 29 dependentshrbrmstr
ggalt:Extra Coordinate Systems, 'Geoms', Statistical Transformations, Scales and Fonts for 'ggplot2'
A compendium of new geometries, coordinate systems, statistical transformations, scales and fonts for 'ggplot2', including splines, 1d and 2d densities, univariate average shifted histograms, a new map coordinate system based on the 'PROJ.4'-library along with geom_cartogram() that mimics the original functionality of geom_map(), formatters for "bytes", a stat_stepribbon() function, increased 'plotly' compatibility and the 'StateFace' open source font 'ProPublica'. Further new functionality includes lollipop charts, dumbbell charts, the ability to encircle points and coordinate-system-based text annotations.
Maintained by Bob Rudis. Last updated 2 years ago.
geomggplot-extensionggplot2ggplot2-geomggplot2-scales
676 stars 12.60 score 2.3k scripts 7 dependentsmassimoaria
bibliometrix:Comprehensive Science Mapping Analysis
Tool for quantitative research in scientometrics and bibliometrics. It implements the comprehensive workflow for science mapping analysis proposed in Aria M. and Cuccurullo C. (2017) <doi:10.1016/j.joi.2017.08.007>. 'bibliometrix' provides various routines for importing bibliographic data from 'SCOPUS', 'Clarivate Analytics Web of Science' (<https://www.webofknowledge.com/>), 'Digital Science Dimensions' (<https://www.dimensions.ai/>), 'OpenAlex' (<https://openalex.org/>), 'Cochrane Library' (<https://www.cochranelibrary.com/>), 'Lens' (<https://lens.org>), and 'PubMed' (<https://pubmed.ncbi.nlm.nih.gov/>) databases, performing bibliometric analysis and building networks for co-citation, coupling, scientific collaboration and co-word analysis.
Maintained by Massimo Aria. Last updated 12 days ago.
bibliometric-analysisbibliometricscitationcitation-networkcitationsco-authorsco-occurenceco-word-analysiscorrespondence-analysiscouplingisi-webjournalmanuscriptquantitative-analysisscholarssciencescience-mappingscientificscientometricsscopus
545 stars 12.54 score 518 scripts 2 dependentsrstudio
flexdashboard:R Markdown Format for Flexible Dashboards
Format for converting an R Markdown document to a grid oriented dashboard. The dashboard flexibly adapts the size of it's components to the containing web page.
Maintained by Garrick Aden-Buie. Last updated 11 months ago.
823 stars 12.49 score 4.5k scripts 8 dependentsr-dbi
bigrquery:An Interface to Google's 'BigQuery' 'API'
Easily talk to Google's 'BigQuery' database from R.
Maintained by Hadley Wickham. Last updated 1 months ago.
520 stars 12.47 score 1.8k scripts 4 dependentsropensci
treeio:Base Classes and Functions for Phylogenetic Tree Input and Output
'treeio' is an R package to make it easier to import and store phylogenetic tree with associated data; and to link external data from different sources to phylogeny. It also supports exporting phylogenetic tree with heterogeneous associated data to a single tree file and can be served as a platform for merging tree with associated data and converting file formats.
Maintained by Guangchuang Yu. Last updated 5 months ago.
softwareannotationclusteringdataimportdatarepresentationalignmentmultiplesequencealignmentphylogeneticsexporterparserphylogenetic-trees
102 stars 12.46 score 1.3k scripts 122 dependentsr-spatial
leafem:'leaflet' Extensions for 'mapview'
Provides extensions for packages 'leaflet' & 'mapdeck', many of which are used by package 'mapview'. Focus is on functionality readily available in Geographic Information Systems such as 'Quantum GIS'. Includes functions to display coordinates of mouse pointer position, query image values via mouse pointer and zoom-to-layer buttons. Additionally, provides a feature type agnostic function to add points, lines, polygons to a map.
Maintained by Tim Appelhans. Last updated 1 months ago.
108 stars 12.41 score 704 scripts 55 dependentsasardaes
dtwclust:Time Series Clustering Along with Optimizations for the Dynamic Time Warping Distance
Time series clustering along with optimized techniques related to the Dynamic Time Warping distance and its corresponding lower bounds. Implementations of partitional, hierarchical, fuzzy, k-Shape and TADPole clustering are available. Functionality can be easily extended with custom distance measures and centroid definitions. Implementations of DTW barycenter averaging, a distance based on global alignment kernels, and the soft-DTW distance and centroid routines are also provided. All included distance functions have custom loops optimized for the calculation of cross-distance matrices, including parallelization support. Several cluster validity indices are included.
Maintained by Alexis Sarda. Last updated 8 months ago.
clusteringdtwtime-seriesopenblascpp
262 stars 12.35 score 406 scripts 14 dependentsjrowen
rhandsontable:Interface to the 'Handsontable.js' Library
An R interface to the 'Handsontable' JavaScript library, which is a minimalist Excel-like data grid editor. See <https://handsontable.com/> for details.
Maintained by Jonathan Owen. Last updated 3 years ago.
handsontablehtmlwidgetsjavascriptshinysparkline
389 stars 12.31 score 1.0k scripts 46 dependentsgaospecial
ggVennDiagram:A 'ggplot2' Implement of Venn Diagram
Easy-to-use functions to generate 2-7 sets Venn or upset plot in publication quality. 'ggVennDiagram' plot Venn or upset using well-defined geometry dataset and 'ggplot2'. The shapes of 2-4 sets Venn use circles and ellipses, while the shapes of 4-7 sets Venn use irregular polygons (4 has both forms), which are developed and imported from another package 'venn', authored by Adrian Dusa. We provided internal functions to integrate shape data with user provided sets data, and calculated the geometry of every regions/intersections of them, then separately plot Venn in four components, set edges/labels, and region edges/labels. From version 1.0, it is possible to customize these components as you demand in ordinary 'ggplot2' grammar. From version 1.4.4, it supports unlimited number of sets, as it can draw a plain upset plot automatically when number of sets is more than 7.
Maintained by Chun-Hui Gao. Last updated 5 months ago.
set-operationsupsetupsetplotvenn-diagramvenn-plot
292 stars 12.31 score 1.3k scripts 4 dependentsbioc
ReactomePA:Reactome Pathway Analysis
This package provides functions for pathway analysis based on REACTOME pathway database. It implements enrichment analysis, gene set enrichment analysis and several functions for visualization. This package is not affiliated with the Reactome team.
Maintained by Guangchuang Yu. Last updated 5 months ago.
pathwaysvisualizationannotationmultiplecomparisongenesetenrichmentreactomeenrichment-analysisreactome-pathway-analysisreactomepa
40 stars 12.25 score 1.5k scripts 7 dependentsyulab-smu
aplot:Decorate a 'ggplot' with Associated Information
For many times, we are not just aligning plots as what 'cowplot' and 'patchwork' did. Users would like to align associated information that requires axes to be exactly matched in subplots, e.g. hierarchical clustering with a heatmap. Inspired by the 'Method 2' in 'ggtree' (G Yu (2018) <doi:10.1093/molbev/msy194>), 'aplot' provides utilities to aligns associated subplots to a main plot at different sides (left, right, top and bottom) with axes exactly matched.
Maintained by Guangchuang Yu. Last updated 1 months ago.
103 stars 12.25 score 520 scripts 118 dependentsbioc
ggbio:Visualization tools for genomic data
The ggbio package extends and specializes the grammar of graphics for biological data. The graphics are designed to answer common scientific questions, in particular those often asked of high throughput genomics data. All core Bioconductor data structures are supported, where appropriate. The package supports detailed views of particular genomic regions, as well as genome-wide overviews. Supported overviews include ideograms and grand linear views. High-level plots include sequence fragment length, edge-linked interval to data view, mismatch pileup, and several splicing summaries.
Maintained by Michael Lawrence. Last updated 5 months ago.
111 stars 12.23 score 734 scripts 16 dependentsrsquaredacademy
olsrr:Tools for Building OLS Regression Models
Tools designed to make it easier for users, particularly beginner/intermediate R users to build ordinary least squares regression models. Includes comprehensive regression output, heteroskedasticity tests, collinearity diagnostics, residual diagnostics, measures of influence, model fit assessment and variable selection procedures.
Maintained by Aravind Hebbali. Last updated 5 months ago.
collinearity-diagnosticslinear-modelsregressionstepwise-regression
103 stars 12.19 score 1.4k scripts 4 dependentsebailey78
shinyBS:Extra Twitter Bootstrap Components for Shiny
Adds easy access to additional Twitter Bootstrap components to Shiny.
Maintained by Eric Bailey. Last updated 9 years ago.
183 stars 12.19 score 3.1k scripts 101 dependentsopenpharma
mmrm:Mixed Models for Repeated Measures
Mixed models for repeated measures (MMRM) are a popular choice for analyzing longitudinal continuous outcomes in randomized clinical trials and beyond; see Cnaan, Laird and Slasor (1997) <doi:10.1002/(SICI)1097-0258(19971030)16:20%3C2349::AID-SIM667%3E3.0.CO;2-E> for a tutorial and Mallinckrodt, Lane, Schnell, Peng and Mancuso (2008) <doi:10.1177/009286150804200402> for a review. This package implements MMRM based on the marginal linear model without random effects using Template Model Builder ('TMB') which enables fast and robust model fitting. Users can specify a variety of covariance matrices, weight observations, fit models with restricted or standard maximum likelihood inference, perform hypothesis testing with Satterthwaite or Kenward-Roger adjustment, and extract least square means estimates by using 'emmeans'.
Maintained by Daniel Sabanes Bove. Last updated 24 days ago.
138 stars 12.15 score 113 scripts 4 dependentsrstudio
shinytest2:Testing for Shiny Applications
Automated unit testing of Shiny applications through a headless 'Chromium' browser.
Maintained by Barret Schloerke. Last updated 5 days ago.
108 stars 12.13 score 704 scripts 1 dependentsgeomorphr
geomorph:Geometric Morphometric Analyses of 2D and 3D Landmark Data
Read, manipulate, and digitize landmark data, generate shape variables via Procrustes analysis for points, curves and surfaces, perform shape analyses, and provide graphical depictions of shapes and patterns of shape variation.
Maintained by Dean Adams. Last updated 2 months ago.
76 stars 12.05 score 700 scripts 6 dependentsdreamrs
fresh:Create Custom 'Bootstrap' Themes to Use in 'Shiny'
Customize 'Bootstrap' and 'Bootswatch' themes, like colors, fonts, grid layout, to use in 'Shiny' applications, 'rmarkdown' documents and 'flexdashboard'.
Maintained by Victor Perrier. Last updated 9 months ago.
bootstrapshinyshiny-applicationsshiny-themes
228 stars 12.03 score 546 scripts 47 dependentsdreamrs
datamods:Modules to Import and Manipulate Data in 'Shiny'
'Shiny' modules to import data into an application or 'addin' from various sources, and to manipulate them after that.
Maintained by Victor Perrier. Last updated 26 days ago.
144 stars 12.03 score 174 scripts 7 dependentscrsh
papaja:Prepare American Psychological Association Journal Articles with R Markdown
Tools to create dynamic, submission-ready manuscripts, which conform to American Psychological Association manuscript guidelines. We provide R Markdown document formats for manuscripts (PDF and Word) and revision letters (PDF). Helper functions facilitate reporting statistical analyses or create publication-ready tables and plots.
Maintained by Frederik Aust. Last updated 1 months ago.
apaapa-guidelinesjournalmanuscriptpsychologyreproducible-paperreproducible-researchrmarkdown
663 stars 12.00 score 1.7k scripts 2 dependentsjinghuazhao
gap:Genetic Analysis Package
As first reported [Zhao, J. H. 2007. "gap: Genetic Analysis Package". J Stat Soft 23(8):1-18. <doi:10.18637/jss.v023.i08>], it is designed as an integrated package for genetic data analysis of both population and family data. Currently, it contains functions for sample size calculations of both population-based and family-based designs, probability of familial disease aggregation, kinship calculation, statistics in linkage analysis, and association analysis involving genetic markers including haplotype analysis with or without environmental covariates. Over years, the package has been developed in-between many projects hence also in line with the name (gap).
Maintained by Jing Hua Zhao. Last updated 6 days ago.
12 stars 11.94 score 448 scripts 16 dependentsrstudio
rticles:Article Formats for R Markdown
A suite of custom R Markdown formats and templates for authoring journal articles and conference submissions.
Maintained by Christophe Dervieux. Last updated 20 days ago.
1.5k stars 11.93 score 188 scripts 3 dependentspecanproject
PEcAn.DB:PEcAn Functions Used for Ecological Forecasts and Reanalysis
The Predictive Ecosystem Carbon Analyzer (PEcAn) is a scientific workflow management tool that is designed to simplify the management of model parameterization, execution, and analysis. The goal of PECAn is to streamline the interaction between data and models, and to improve the efficacy of scientific investigation.
Maintained by David LeBauer. Last updated 8 hours ago.
bayesiancyberinfrastructuredata-assimilationdata-scienceecosystem-modelecosystem-scienceforecastingmeta-analysisnational-science-foundationpecanplants
216 stars 11.91 score 127 scripts 27 dependentsrstudio
r2d3:Interface to 'D3' Visualizations
Suite of tools for using 'D3', a library for producing dynamic, interactive data visualizations. Supports translating objects into 'D3' friendly data structures, rendering 'D3' scripts, publishing 'D3' visualizations, incorporating 'D3' in R Markdown, creating interactive 'D3' applications with Shiny, and distributing 'D3' based 'htmlwidgets' in R packages.
Maintained by Nick Strayer. Last updated 3 years ago.
519 stars 11.88 score 498 scripts 10 dependentsbioc
QFeatures:Quantitative features for mass spectrometry data
The QFeatures infrastructure enables the management and processing of quantitative features for high-throughput mass spectrometry assays. It provides a familiar Bioconductor user experience to manages quantitative data across different assay levels (such as peptide spectrum matches, peptides and proteins) in a coherent and tractable format.
Maintained by Laurent Gatto. Last updated 27 days ago.
infrastructuremassspectrometryproteomicsmetabolomicsbioconductormass-spectrometry
27 stars 11.87 score 278 scripts 49 dependentstrestletech
shinyAce:Ace Editor Bindings for Shiny
Ace editor bindings to enable a rich text editing environment within Shiny.
Maintained by Vincent Nijs. Last updated 2 months ago.
222 stars 11.86 score 388 scripts 64 dependentsrinterface
shinyMobile:Mobile Ready 'shiny' Apps with Standalone Capabilities
Develop outstanding 'shiny' apps for 'iOS' and 'Android' as well as beautiful 'shiny' gadgets. 'shinyMobile' is built on top of the latest 'Framework7' template <https://framework7.io>. Discover 14 new input widgets (sliders, vertical sliders, stepper, grouped action buttons, toggles, picker, smart select, ...), 2 themes (light and dark), 12 new widgets (expandable cards, badges, chips, timelines, gauges, progress bars, ...) combined with the power of server-side notifications such as alerts, modals, toasts, action sheets, sheets (and more) as well as 3 layouts (single, tabs and split).
Maintained by David Granjon. Last updated 2 months ago.
androidhacktoberfest2022pwashinyshinyappstemplate
410 stars 11.85 score 1.1k scripts 2 dependentsguangchuangyu
hexSticker:Create Hexagon Sticker in R
Helper functions for creating reproducible hexagon sticker purely in R.
Maintained by Guangchuang Yu. Last updated 2 months ago.
ggplot2hexagon-stickerlogostickersvisualization
773 stars 11.79 score 1.3k scripts 8 dependentsfriendly
heplots:Visualizing Hypothesis Tests in Multivariate Linear Models
Provides HE plot and other functions for visualizing hypothesis tests in multivariate linear models. HE plots represent sums-of-squares-and-products matrices for linear hypotheses and for error using ellipses (in two dimensions) and ellipsoids (in three dimensions). The related 'candisc' package provides visualizations in a reduced-rank canonical discriminant space when there are more than a few response variables.
Maintained by Michael Friendly. Last updated 8 days ago.
linear-hypothesesmatricesmultivariate-linear-modelsplotrepeated-measure-designsvisualizing-hypothesis-tests
9 stars 11.78 score 1.1k scripts 7 dependentskevinushey
sourcetools:Tools for Reading, Tokenizing and Parsing R Code
Tools for Reading, Tokenizing and Parsing R Code.
Maintained by Kevin Ushey. Last updated 2 years ago.
78 stars 11.77 score 32 scripts 1.8k dependentsthomasp85
shinyFiles:A Server-Side File System Viewer for Shiny
Provides functionality for client-side navigation of the server side file system in shiny apps. In case the app is running locally this gives the user direct access to the file system without the need to "download" files to a temporary location. Both file and folder selection as well as file saving is available.
Maintained by Thomas Lin Pedersen. Last updated 2 years ago.
199 stars 11.77 score 736 scripts 62 dependentsdaattali
colourpicker:A Colour Picker Tool for Shiny and for Selecting Colours in Plots
A colour picker that can be used as an input in 'Shiny' apps or Rmarkdown documents. The colour picker supports alpha opacity, custom colour palettes, and many more options. A Plot Colour Helper tool is available as an 'RStudio' Addin, which helps you pick colours to use in your plots. A more generic Colour Picker 'RStudio' Addin is also provided to let you select colours to use in your R code.
Maintained by Dean Attali. Last updated 8 months ago.
222 stars 11.76 score 936 scripts 120 dependentsdatalorax
equatiomatic:Transform Models into 'LaTeX' Equations
The goal of 'equatiomatic' is to reduce the pain associated with writing 'LaTeX' formulas from fitted models. The primary function of the package, extract_eq(), takes a fitted model object as its input and returns the corresponding 'LaTeX' code for the model.
Maintained by Philippe Grosjean. Last updated 22 days ago.
619 stars 11.75 score 424 scripts 5 dependentsrstudio
pagedown:Paginate the HTML Output of R Markdown with CSS for Print
Use the paged media properties in CSS and the JavaScript library 'paged.js' to split the content of an HTML document into discrete pages. Each page can have its page size, page numbers, margin boxes, and running headers, etc. Applications of this package include books, letters, reports, papers, business cards, resumes, and posters.
Maintained by Yihui Xie. Last updated 3 months ago.
csshtmlpaged-mediapdfprintingtypesetting
909 stars 11.73 score 350 scripts 19 dependentsjbryer
likert:Analysis and Visualization Likert Items
An approach to analyzing Likert response items, with an emphasis on visualizations. The stacked bar plot is the preferred method for presenting Likert results. Tabular results are also implemented along with density plots to assist researchers in determining whether Likert responses can be used quantitatively instead of qualitatively. See the likert(), summary.likert(), and plot.likert() functions to get started.
Maintained by Jason Bryer. Last updated 5 days ago.
310 stars 11.71 score 480 scripts 2 dependentsbwlewis
threejs:Interactive 3D Scatter Plots, Networks and Globes
Create interactive 3D scatter plots, network plots, and globes using the 'three.js' visualization library (<https://threejs.org>).
Maintained by B. W. Lewis. Last updated 3 years ago.
data-visualizationgraph-animationigraphthreejswebgl
304 stars 11.67 score 522 scripts 28 dependentsjthomasmock
gtExtras:Extending 'gt' for Beautiful HTML Tables
Provides additional functions for creating beautiful tables with 'gt'. The functions are generally wrappers around boilerplate or adding opinionated niche capabilities and helpers functions.
Maintained by Thomas Mock. Last updated 12 months ago.
data-sciencedata-visualizationdatascienceggplot2gtplotssparklinesparkline-graphssparklinestables
201 stars 11.66 score 2.4k scripts 5 dependentshaleyjeppson
ggmosaic:Mosaic Plots in the 'ggplot2' Framework
Mosaic plots in the 'ggplot2' framework. Mosaic plot functionality is provided in a single 'ggplot2' layer by calling the geom 'mosaic'.
Maintained by Haley Jeppson. Last updated 6 months ago.
167 stars 11.63 score 1.8k scripts 4 dependentspecanproject
PEcAn.data.atmosphere:PEcAn Functions Used for Managing Climate Driver Data
The Predictive Ecosystem Carbon Analyzer (PEcAn) is a scientific workflow management tool that is designed to simplify the management of model parameterization, execution, and analysis. The PECAn.data.atmosphere package converts climate driver data into a standard format for models integrated into PEcAn. As a standalone package, it provides an interface to access diverse climate data sets.
Maintained by David LeBauer. Last updated 8 hours ago.
bayesiancyberinfrastructuredata-assimilationdata-scienceecosystem-modelecosystem-scienceforecastingmeta-analysisnational-science-foundationpecanplants
216 stars 11.63 score 64 scripts 14 dependentsrstudio
sortable:Drag-and-Drop in 'shiny' Apps with 'SortableJS'
Enables drag-and-drop behaviour in Shiny apps, by exposing the functionality of the 'SortableJS' <https://sortablejs.github.io/Sortable/> JavaScript library as an 'htmlwidget'. You can use this in Shiny apps and widgets, 'learnr' tutorials as well as R Markdown. In addition, provides a custom 'learnr' question type - 'question_rank()' - that allows ranking questions with drag-and-drop.
Maintained by Andrie de Vries. Last updated 7 months ago.
135 stars 11.62 score 368 scripts 13 dependentsr-lib
mockery:Mocking Library for R
The two main functionalities of this package are creating mock objects (functions) and selectively intercepting calls to a given function that originate in some other function. It can be used with any testing framework available for R. Mock objects can be injected with either this package's own stub() function or a similar with_mock() facility present in the 'testthat' package.
Maintained by Hadley Wickham. Last updated 1 years ago.
100 stars 11.57 score 504 scripts 5 dependentsrstudio
blogdown:Create Blogs and Websites with R Markdown
Write blog posts and web pages in R Markdown. This package supports the static site generator 'Hugo' (<https://gohugo.io>) best, and it also supports 'Jekyll' (<https://jekyllrb.com>) and 'Hexo' (<https://hexo.io>).
Maintained by Yihui Xie. Last updated 15 days ago.
blog-engineblogdownhugormarkdownrstudiowebsite-generation
1.8k stars 11.55 score 1.4k scripts 1 dependentstylermorganwall
rayshader:Create Maps and Visualize Data in 2D and 3D
Uses a combination of raytracing and multiple hill shading methods to produce 2D and 3D data visualizations and maps. Includes water detection and layering functions, programmable color palette generation, several built-in textures for hill shading, 2D and 3D plotting options, a built-in path tracer, 'Wavefront' OBJ file export, and the ability to save 3D visualizations to a 3D printable format.
Maintained by Tyler Morgan-Wall. Last updated 2 months ago.
2.1k stars 11.55 score 1.5k scripts 5 dependentsworkflowr
workflowr:A Framework for Reproducible and Collaborative Data Science
Provides a workflow for your analysis projects by combining literate programming ('knitr' and 'rmarkdown') and version control ('Git', via 'git2r') to generate a website containing time-stamped, versioned, and documented results.
Maintained by John Blischak. Last updated 4 months ago.
gitproject-managementrmarkdownwebsiteworkflow
848 stars 11.53 score 566 scriptsurbananalyst
dodgr:Distances on Directed Graphs
Distances on dual-weighted directed graphs using priority-queue shortest paths (Padgham (2019) <doi:10.32866/6945>). Weighted directed graphs have weights from A to B which may differ from those from B to A. Dual-weighted directed graphs have two sets of such weights. A canonical example is a street network to be used for routing in which routes are calculated by weighting distances according to the type of way and mode of transport, yet lengths of routes must be calculated from direct distances.
Maintained by Mark Padgham. Last updated 3 days ago.
distanceopenstreetmaproutershortest-pathsstreet-networkscpp
129 stars 11.52 score 229 scripts 4 dependentsbioc
systemPipeR:systemPipeR: Workflow Environment for Data Analysis and Report Generation
systemPipeR is a multipurpose data analysis workflow environment that unifies R with command-line tools. It enables scientists to analyze many types of large- or small-scale data on local or distributed computer systems with a high level of reproducibility, scalability and portability. At its core is a command-line interface (CLI) that adopts the Common Workflow Language (CWL). This design allows users to choose for each analysis step the optimal R or command-line software. It supports both end-to-end and partial execution of workflows with built-in restart functionalities. Efficient management of complex analysis tasks is accomplished by a flexible workflow control container class. Handling of large numbers of input samples and experimental designs is facilitated by consistent sample annotation mechanisms. As a multi-purpose workflow toolkit, systemPipeR enables users to run existing workflows, customize them or design entirely new ones while taking advantage of widely adopted data structures within the Bioconductor ecosystem. Another important core functionality is the generation of reproducible scientific analysis and technical reports. For result interpretation, systemPipeR offers a wide range of plotting functionality, while an associated Shiny App offers many useful functionalities for interactive result exploration. The vignettes linked from this page include (1) a general introduction, (2) a description of technical details, and (3) a collection of workflow templates.
Maintained by Thomas Girke. Last updated 5 months ago.
geneticsinfrastructuredataimportsequencingrnaseqriboseqchipseqmethylseqsnpgeneexpressioncoveragegenesetenrichmentalignmentqualitycontrolimmunooncologyreportwritingworkflowstepworkflowmanagement
53 stars 11.52 score 344 scripts 3 dependentsbioc
mia:Microbiome analysis
mia implements tools for microbiome analysis based on the SummarizedExperiment, SingleCellExperiment and TreeSummarizedExperiment infrastructure. Data wrangling and analysis in the context of taxonomic data is the main scope. Additional functions for common task are implemented such as community indices calculation and summarization.
Maintained by Tuomas Borman. Last updated 4 days ago.
microbiomesoftwaredataimportanalysisbioconductorcpp
51 stars 11.51 score 316 scripts 5 dependentsr-lib
gmailr:Access the 'Gmail' 'RESTful' API
An interface to the 'Gmail' 'RESTful' API. Allows access to your 'Gmail' messages, threads, drafts and labels.
Maintained by Jennifer Bryan. Last updated 1 years ago.
230 stars 11.50 score 289 scripts 1 dependentsjohncoene
echarts4r:Create Interactive Graphs with 'Echarts JavaScript' Version 5
Easily create interactive charts by leveraging the 'Echarts Javascript' library which includes 36 chart types, themes, 'Shiny' proxies and animations.
Maintained by David Munoz Tord. Last updated 18 days ago.
echartshacktoberfesthtmlwidgethtmlwidgetsvisualization
603 stars 11.45 score 1.3k scripts 11 dependentssachaepskamp
qgraph:Graph Plotting Methods, Psychometric Data Visualization and Graphical Model Estimation
Fork of qgraph - Weighted network visualization and analysis, as well as Gaussian graphical model computation. See Epskamp et al. (2012) <doi:10.18637/jss.v048.i04>.
Maintained by Sacha Epskamp. Last updated 1 years ago.
69 stars 11.43 score 1.2k scripts 63 dependentsmllg
batchtools:Tools for Computation on Batch Systems
As a successor of the packages 'BatchJobs' and 'BatchExperiments', this package provides a parallel implementation of the Map function for high performance computing systems managed by schedulers 'IBM Spectrum LSF' (<https://www.ibm.com/products/hpc-workload-management>), 'OpenLava' (<https://www.openlava.org/>), 'Univa Grid Engine'/'Oracle Grid Engine' (<https://www.univa.com/>), 'Slurm' (<https://slurm.schedmd.com/>), 'TORQUE/PBS' (<https://adaptivecomputing.com/cherry-services/torque-resource-manager/>), or 'Docker Swarm' (<https://docs.docker.com/engine/swarm/>). A multicore and socket mode allow the parallelization on a local machines, and multiple machines can be hooked up via SSH to create a makeshift cluster. Moreover, the package provides an abstraction mechanism to define large-scale computer experiments in a well-organized and reproducible way.
Maintained by Michel Lang. Last updated 2 years ago.
batchexperimentsbatchjobsdocker-swarmhigh-performance-computinghpchpc-clusterslsfopenlavaparallel-computingreproducibilitysgeslurmtorque
175 stars 11.39 score 772 scripts 14 dependentsopenintrostat
openintro:Datasets and Supplemental Functions from 'OpenIntro' Textbooks and Labs
Supplemental functions and data for 'OpenIntro' resources, which includes open-source textbooks and resources for introductory statistics (<https://www.openintro.org/>). The package contains datasets used in our open-source textbooks along with custom plotting functions for reproducing book figures. Note that many functions and examples include color transparency; some plotting elements may not show up properly (or at all) when run in some versions of Windows operating system.
Maintained by Mine รetinkaya-Rundel. Last updated 3 months ago.
240 stars 11.39 score 6.0k scriptsbioc
PharmacoGx:Analysis of Large-Scale Pharmacogenomic Data
Contains a set of functions to perform large-scale analysis of pharmaco-genomic data. These include the PharmacoSet object for storing the results of pharmacogenomic experiments, as well as a number of functions for computing common summaries of drug-dose response and correlating them with the molecular features in a cancer cell-line.
Maintained by Benjamin Haibe-Kains. Last updated 3 months ago.
geneexpressionpharmacogeneticspharmacogenomicssoftwareclassificationdatasetspharmacogenomicpharmacogxcpp
68 stars 11.39 score 442 scripts 3 dependentsr4ss
r4ss:R Code for Stock Synthesis
A collection of R functions for use with Stock Synthesis, a fisheries stock assessment modeling platform written in ADMB by Dr. Richard D. Methot at the NOAA Northwest Fisheries Science Center. The functions include tools for summarizing and plotting results, manipulating files, visualizing model parameterizations, and various other common stock assessment tasks. This version of '{r4ss}' is compatible with Stock Synthesis versions 3.24 through 3.30 (specifically version 3.30.23.1, from December 2024). Support for 3.24 models is only through the core functions for reading output and plotting.
Maintained by Ian G. Taylor. Last updated 20 days ago.
fisheriesfisheries-stock-assessmentstock-synthesis
43 stars 11.38 score 1.0k scripts 2 dependentsrolkra
explore:Simplifies Exploratory Data Analysis
Interactive data exploration with one line of code, automated reporting or use an easy to remember set of tidy functions for low code exploratory data analysis.
Maintained by Roland Krasser. Last updated 19 hours ago.
data-explorationdata-visualisationdecision-treesedarmarkdownshinytidy
230 stars 11.36 score 221 scripts 1 dependentsropensci
biomartr:Genomic Data Retrieval
Perform large scale genomic data retrieval and functional annotation retrieval. This package aims to provide users with a standardized way to automate genome, proteome, 'RNA', coding sequence ('CDS'), 'GFF', and metagenome retrieval from 'NCBI RefSeq', 'NCBI Genbank', 'ENSEMBL', and 'UniProt' databases. Furthermore, an interface to the 'BioMart' database (Smedley et al. (2009) <doi:10.1186/1471-2164-10-22>) allows users to retrieve functional annotation for genomic loci. In addition, users can download entire databases such as 'NCBI RefSeq' (Pruitt et al. (2007) <doi:10.1093/nar/gkl842>), 'NCBI nr', 'NCBI nt', 'NCBI Genbank' (Benson et al. (2013) <doi:10.1093/nar/gks1195>), etc. with only one command.
Maintained by Hajk-Georg Drost. Last updated 2 months ago.
biomartgenomic-data-retrievalannotation-retrievaldatabase-retrievalncbiensemblbiological-data-retrievalensembl-serversgenomegenome-annotationgenome-retrievalgenomicsmeta-analysismetagenomicsncbi-genbankpeer-reviewedproteomesequenced-genomes
218 stars 11.35 score 129 scripts 3 dependentsdsy109
mixtools:Tools for Analyzing Finite Mixture Models
Analyzes finite mixture models for various parametric and semiparametric settings. This includes mixtures of parametric distributions (normal, multivariate normal, multinomial, gamma), various Reliability Mixture Models (RMMs), mixtures-of-regressions settings (linear regression, logistic regression, Poisson regression, linear regression with changepoints, predictor-dependent mixing proportions, random effects regressions, hierarchical mixtures-of-experts), and tools for selecting the number of components (bootstrapping the likelihood ratio test statistic, mixturegrams, and model selection criteria). Bayesian estimation of mixtures-of-linear-regressions models is available as well as a novel data depth method for obtaining credible bands. This package is based upon work supported by the National Science Foundation under Grant No. SES-0518772 and the Chan Zuckerberg Initiative: Essential Open Source Software for Science (Grant No. 2020-255193).
Maintained by Derek Young. Last updated 10 months ago.
mixture-modelsmixture-of-expertssemiparametric-regression
20 stars 11.34 score 1.4k scripts 56 dependentsbioc
BiocStyle:Standard styles for vignettes and other Bioconductor documents
Provides standard formatting styles for Bioconductor PDF and HTML documents. Package vignettes illustrate use and functionality.
Maintained by Bioconductor Package Maintainer. Last updated 5 months ago.
softwarebioconductor-packagecore-package
12 stars 11.31 score 1.2k scripts 47 dependentsneuhausi
canvasXpress:Visualization Package for CanvasXpress in R
Enables creation of visualizations using the CanvasXpress framework in R. CanvasXpress is a standalone JavaScript library for reproducible research with complete tracking of data and end-user modifications stored in a single PNG image that can be played back. See <https://www.canvasxpress.org> for more information.
Maintained by Connie Brett. Last updated 3 days ago.
analyticsbioinformaticschartchartingdashdashboarddata-analyticsdata-sciencedata-visualizationgenomicsgraphsjavascriptnetworknetwork-visualizationpythonreproducible-researchshinyvisualization
297 stars 11.28 score 145 scriptsropensci
tarchetypes:Archetypes for Targets
Function-oriented Make-like declarative pipelines for Statistics and data science are supported in the 'targets' R package. As an extension to 'targets', the 'tarchetypes' package provides convenient user-side functions to make 'targets' easier to use. By establishing reusable archetypes for common kinds of targets and pipelines, these functions help express complicated reproducible pipelines concisely and compactly. The methods in this package were influenced by the 'targets' R package. by Will Landau (2018) <doi:10.21105/joss.00550>.
Maintained by William Michael Landau. Last updated 3 days ago.
data-sciencehigh-performance-computingpeer-reviewedpipeliner-targetopiareproducibilitytargetsworkflow
142 stars 11.27 score 1.7k scripts 10 dependentsmrcieu
TwoSampleMR:Two Sample MR Functions and Interface to MRC Integrative Epidemiology Unit OpenGWAS Database
A package for performing Mendelian randomization using GWAS summary data. It uses the IEU OpenGWAS database <https://gwas.mrcieu.ac.uk/> to automatically obtain data, and a wide range of methods to run the analysis.
Maintained by Gibran Hemani. Last updated 3 days ago.
476 stars 11.27 score 1.7k scripts 1 dependentsbioc
karyoploteR:Plot customizable linear genomes displaying arbitrary data
karyoploteR creates karyotype plots of arbitrary genomes and offers a complete set of functions to plot arbitrary data on them. It mimicks many R base graphics functions coupling them with a coordinate change function automatically mapping the chromosome and data coordinates into the plot coordinates. In addition to the provided data plotting functions, it is easy to add new ones.
Maintained by Bernat Gel. Last updated 5 months ago.
visualizationcopynumbervariationsequencingcoveragednaseqchipseqmethylseqdataimportonechannelbioconductorbioinformaticsdata-visualizationgenomegenomics-visualizationplotting-in-r
307 stars 11.25 score 656 scripts 4 dependentsdreamrs
shinybusy:Busy Indicators and Notifications for 'Shiny' Applications
Add indicators (spinner, progress bar, gif) in your 'shiny' applications to show the user that the server is busy. And other tools to let your users know something is happening (send notifications, reports, ...).
Maintained by Victor Perrier. Last updated 7 months ago.
144 stars 11.23 score 772 scripts 39 dependentsboxuancui
DataExplorer:Automate Data Exploration and Treatment
Automated data exploration process for analytic tasks and predictive modeling, so that users could focus on understanding data and extracting insights. The package scans and analyzes each variable, and visualizes them with typical graphical techniques. Common data processing methods are also available to treat and format data.
Maintained by Boxuan Cui. Last updated 1 years ago.
data-analysisdata-explorationdata-scienceedavisualization
523 stars 11.21 score 2.2k scriptsropensci
EML:Read and Write Ecological Metadata Language Files
Work with Ecological Metadata Language ('EML') files. 'EML' is a widely used metadata standard in the ecological and environmental sciences, described in Jones et al. (2006), <doi:10.1146/annurev.ecolsys.37.091305.110031>.
Maintained by Carl Boettiger. Last updated 3 years ago.
emleml-metadatametadata-standard
97 stars 11.19 score 378 scripts 7 dependentsdaattali
shinyalert:Easily Create Pretty Popup Messages (Modals) in 'Shiny'
Easily create pretty popup messages (modals) in 'Shiny'. A modal can contain text, images, OK/Cancel buttons, an input to get a response from the user, and many more customizable options.
Maintained by Dean Attali. Last updated 10 months ago.
243 stars 11.16 score 1.3k scripts 25 dependentsadeverse
adespatial:Multivariate Multiscale Spatial Analysis
Tools for the multiscale spatial analysis of multivariate data. Several methods are based on the use of a spatial weighting matrix and its eigenvector decomposition (Moran's Eigenvectors Maps, MEM). Several approaches are described in the review Dray et al (2012) <doi:10.1890/11-1183.1>.
Maintained by Aurรฉlie Siberchicot. Last updated 11 days ago.
36 stars 11.16 score 398 scripts 2 dependentsguangchuangyu
ggimage:Use Image in 'ggplot2'
Supports image files and graphic objects to be visualized in 'ggplot2' graphic system.
Maintained by Guangchuang Yu. Last updated 1 years ago.
172 stars 11.12 score 2.4k scripts 20 dependentsjgx65
hierfstat:Estimation and Tests of Hierarchical F-Statistics
Estimates hierarchical F-statistics from haploid or diploid genetic data with any numbers of levels in the hierarchy, following the algorithm of Yang (Evolution(1998), 52:950). Tests via randomisations the significance of each F and variance components, using the likelihood-ratio statistics G (Goudet et al. (1996) <https://academic.oup.com/genetics/article/144/4/1933/6017091>). Estimates genetic diversity statistics for haploid and diploid genetic datasets in various formats, including inbreeding and coancestry coefficients, and population specific F-statistics following Weir and Goudet (2017) <https://academic.oup.com/genetics/article/206/4/2085/6072590>.
Maintained by Jerome Goudet. Last updated 4 months ago.
devtoolsfstatisticsgwashierfstatkinshippopulation-geneticspopulation-genomicsquantitative-geneticssimulations
25 stars 11.06 score 560 scripts 5 dependentschoonghyunryu
dlookr:Tools for Data Diagnosis, Exploration, Transformation
A collection of tools that support data diagnosis, exploration, and transformation. Data diagnostics provides information and visualization of missing values, outliers, and unique and negative values to help you understand the distribution and quality of your data. Data exploration provides information and visualization of the descriptive statistics of univariate variables, normality tests and outliers, correlation of two variables, and the relationship between the target variable and predictor. Data transformation supports binning for categorizing continuous variables, imputes missing values and outliers, and resolves skewness. And it creates automated reports that support these three tasks.
Maintained by Choonghyun Ryu. Last updated 10 months ago.
212 stars 11.05 score 748 scripts 2 dependentsmhahsler
arulesViz:Visualizing Association Rules and Frequent Itemsets
Extends package 'arules' with various visualization techniques for association rules and itemsets. The package also includes several interactive visualizations for rule exploration. Michael Hahsler (2017) <doi:10.32614/RJ-2017-047>.
Maintained by Michael Hahsler. Last updated 7 months ago.
arulesassociation-rulesfrequent-itemsetsinteractive-visualizationsvisualization
54 stars 11.03 score 1.7k scripts 2 dependentspik-piam
madrat:May All Data be Reproducible and Transparent (MADRaT) *
Provides a framework which should improve reproducibility and transparency in data processing. It provides functionality such as automatic meta data creation and management, rudimentary quality management, data caching, work-flow management and data aggregation. * The title is a wish not a promise. By no means we expect this package to deliver everything what is needed to achieve full reproducibility and transparency, but we believe that it supports efforts in this direction.
Maintained by Jan Philipp Dietrich. Last updated 11 days ago.
15 stars 11.03 score 83 scripts 38 dependentsgdemin
expss:Tables, Labels and Some Useful Functions from Spreadsheets and 'SPSS' Statistics
Package computes and displays tables with support for 'SPSS'-style labels, multiple and nested banners, weights, multiple-response variables and significance testing. There are facilities for nice output of tables in 'knitr', 'Shiny', '*.xlsx' files, R and 'Jupyter' notebooks. Methods for labelled variables add value labels support to base R functions and to some functions from other packages. Additionally, the package brings popular data transformation functions from 'SPSS' Statistics and 'Excel': 'RECODE', 'COUNT', 'COUNTIF', 'VLOOKUP' and etc. These functions are very useful for data processing in marketing research surveys. Package intended to help people to move data processing from 'Excel' and 'SPSS' to R.
Maintained by Gregory Demin. Last updated 12 months ago.
excellabelslabels-supportmsexcelpivot-tablesrecodespssspss-statisticstablesvariable-labelsvlookup
84 stars 11.00 score 1.8k scripts 4 dependentssachsmc
plotROC:Generate Useful ROC Curve Charts for Print and Interactive Use
Most ROC curve plots obscure the cutoff values and inhibit interpretation and comparison of multiple curves. This attempts to address those shortcomings by providing plotting and interactive tools. Functions are provided to generate an interactive ROC curve plot for web use, and print versions. A Shiny application implementing the functions is also included.
Maintained by Michael C. Sachs. Last updated 5 months ago.
87 stars 10.93 score 932 scripts 7 dependentsdavidgohel
officedown:Enhanced 'R Markdown' Format for 'Word' and 'PowerPoint'
Allows production of 'Microsoft' corporate documents from 'R Markdown' by reusing formatting defined in 'Microsoft Word' documents. You can reuse table styles, list styles but also add column sections, landscape oriented pages. Table and image captions as well as cross-references are transformed into 'Microsoft Word' fields, allowing documents edition and merging without issue with references; the syntax conforms to the 'bookdown' cross-reference definition. Objects generated by the 'officer' package are also supported in the 'knitr' chunks. 'Microsoft PowerPoint' presentations also benefit from this as well as the ability to produce editable vector graphics in 'PowerPoint' and also to define placeholder where content is to be added.
Maintained by David Gohel. Last updated 13 days ago.
371 stars 10.93 score 342 scripts 7 dependentsbioc
infercnv:Infer Copy Number Variation from Single-Cell RNA-Seq Data
Using single-cell RNA-Seq expression to visualize CNV in cells.
Maintained by Christophe Georgescu. Last updated 5 months ago.
softwarecopynumbervariationvariantdetectionstructuralvariationgenomicvariationgeneticstranscriptomicsstatisticalmethodbayesianhiddenmarkovmodelsinglecelljagscpp
601 stars 10.92 score 674 scriptstylermorganwall
rayrender:Build and Raytrace 3D Scenes
Render scenes using pathtracing. Build 3D scenes out of spheres, cubes, planes, disks, triangles, cones, curves, line segments, cylinders, ellipsoids, and 3D models in the 'Wavefront' OBJ file format or the PLY Polygon File Format. Supports several material types, textures, multicore rendering, and tone-mapping. Based on the "Ray Tracing in One Weekend" book series. Peter Shirley (2018) <https://raytracing.github.io>.
Maintained by Tyler Morgan-Wall. Last updated 4 days ago.
631 stars 10.87 score 188 scripts 8 dependentsmarce10
warbleR:Streamline Bioacoustic Analysis
Functions aiming to facilitate the analysis of the structure of animal acoustic signals in 'R'. 'warbleR' makes use of the basic sound analysis tools from the packages 'tuneR' and 'seewave', and offers new tools for explore and quantify acoustic signal structure. The package allows to organize and manipulate multiple sound files, create spectrograms of complete recordings or individual signals in different formats, run several measures of acoustic structure, and characterize different structural levels in acoustic signals.
Maintained by Marcelo Araya-Salas. Last updated 2 months ago.
animal-acoustic-signalsaudio-processingbioacousticsspectrogramstreamline-analysiscpp
56 stars 10.86 score 270 scripts 4 dependentsmichelnivard
gptstudio:Use Large Language Models Directly in your Development Environment
Large language models are readily accessible via API. This package lowers the barrier to use the API inside of your development environment. For more on the API, see <https://platform.openai.com/docs/introduction>.
Maintained by James Wade. Last updated 5 days ago.
chatgptgpt-3rstudiorstudio-addin
930 stars 10.85 score 43 scripts 1 dependentsr-lib
vdiffr:Visual Regression Testing and Graphical Diffing
An extension to the 'testthat' package that makes it easy to add graphical unit tests. It provides a Shiny application to manage the test cases.
Maintained by Lionel Henry. Last updated 5 months ago.
ggplot2graphicstestthatlibpngcpp
191 stars 10.84 score 254 scripts 5 dependentsgrunwaldlab
poppr:Genetic Analysis of Populations with Mixed Reproduction
Population genetic analyses for hierarchical analysis of partially clonal populations built upon the architecture of the 'adegenet' package. Originally described in Kamvar, Tabima, and Grรผnwald (2014) <doi:10.7717/peerj.281> with version 2.0 described in Kamvar, Brooks, and Grรผnwald (2015) <doi:10.3389/fgene.2015.00208>.
Maintained by Zhian N. Kamvar. Last updated 11 months ago.
clonalitygenetic-analysisgenetic-distancesminimum-spanning-networksmultilocus-genotypesmultilocus-lineagespopulation-geneticspopulationsopenmp
69 stars 10.84 score 672 scriptsmoodymudskipper
flow:View and Browse Code Using Flow Diagrams
Visualize as flow diagrams the logic of functions, expressions or scripts in a static way or when running a call, visualize the dependencies between functions or between modules in a shiny app, and more.
Maintained by Antoine Fabri. Last updated 4 months ago.
405 stars 10.84 score 61 scriptsyang-tang
shinyjqui:'jQuery UI' Interactions and Effects for Shiny
An extension to shiny that brings interactions and animation effects from 'jQuery UI' library.
Maintained by Yang Tang. Last updated 1 years ago.
276 stars 10.83 score 464 scripts 19 dependentsbioc
ANCOMBC:Microbiome differential abudance and correlation analyses with bias correction
ANCOMBC is a package containing differential abundance (DA) and correlation analyses for microbiome data. Specifically, the package includes Analysis of Compositions of Microbiomes with Bias Correction 2 (ANCOM-BC2), Analysis of Compositions of Microbiomes with Bias Correction (ANCOM-BC), and Analysis of Composition of Microbiomes (ANCOM) for DA analysis, and Sparse Estimation of Correlations among Microbiomes (SECOM) for correlation analysis. Microbiome data are typically subject to two sources of biases: unequal sampling fractions (sample-specific biases) and differential sequencing efficiencies (taxon-specific biases). Methodologies included in the ANCOMBC package are designed to correct these biases and construct statistically consistent estimators.
Maintained by Huang Lin. Last updated 15 days ago.
differentialexpressionmicrobiomenormalizationsequencingsoftwareancomancombcancombc2correlationdifferential-abundance-analysissecom
120 stars 10.79 score 406 scripts 1 dependentsmitchelloharawild
vitae:Curriculum Vitae for R Markdown
Provides templates and functions to simplify the production and maintenance of curriculum vitae.
Maintained by Mitchell OHara-Wild. Last updated 10 months ago.
1.2k stars 10.78 score 556 scriptsovvo-financial
NNS:Nonlinear Nonparametric Statistics
Nonlinear nonparametric statistics using partial moments. Partial moments are the elements of variance and asymptotically approximate the area of f(x). These robust statistics provide the basis for nonlinear analysis while retaining linear equivalences. NNS offers: Numerical integration, Numerical differentiation, Clustering, Correlation, Dependence, Causal analysis, ANOVA, Regression, Classification, Seasonality, Autoregressive modeling, Normalization, Stochastic dominance and Advanced Monte Carlo sampling. All routines based on: Viole, F. and Nawrocki, D. (2013), Nonlinear Nonparametric Statistics: Using Partial Moments (ISBN: 1490523995).
Maintained by Fred Viole. Last updated 3 days ago.
clusteringeconometricsmachine-learningnonlinearnonparametricpartial-momentsstatisticstime-seriescpp
72 stars 10.77 score 66 scripts 3 dependentspecanproject
PEcAn.benchmark:PEcAn Functions Used for Benchmarking
The Predictive Ecosystem Carbon Analyzer (PEcAn) is a scientific workflow management tool that is designed to simplify the management of model parameterization, execution, and analysis. The goal of PEcAn is to streamline the interaction between data and models, and to improve the efficacy of scientific investigation. The PEcAn.benchmark package provides utilities for comparing models and data, including a suite of statistical metrics and plots.
Maintained by Mike Dietze. Last updated 8 hours ago.
bayesiancyberinfrastructuredata-assimilationdata-scienceecosystem-modelecosystem-scienceforecastingmeta-analysisnational-science-foundationpecanplants
216 stars 10.73 score 416 scripts 11 dependentshtmlwidgets
sparkline:'jQuery' Sparkline 'htmlwidget'
Include interactive sparkline charts <http://omnipotent.net/jquery.sparkline> in all R contexts with the convenience of 'htmlwidgets'.
Maintained by Ramnath Vaidyanathan. Last updated 6 years ago.
245 stars 10.73 score 556 scripts 5 dependentsrstudio
pointblank:Data Validation and Organization of Metadata for Local and Remote Tables
Validate data in data frames, 'tibble' objects, 'Spark' 'DataFrames', and database tables. Validation pipelines can be made using easily-readable, consecutive validation steps. Upon execution of the validation plan, several reporting options are available. User-defined thresholds for failure rates allow for the determination of appropriate reporting actions. Many other workflows are available including an information management workflow, where the aim is to record, collect, and generate useful information on data tables.
Maintained by Richard Iannone. Last updated 5 days ago.
data-assertionsdata-checkerdata-dictionariesdata-framesdata-inferencedata-managementdata-profilerdata-qualitydata-validationdata-verificationdatabase-tableseasy-to-understandreporting-toolschema-validationtesting-toolsyaml-configuration
942 stars 10.73 score 284 scriptssachaepskamp
semPlot:Path Diagrams and Visual Analysis of Various SEM Packages' Output
Path diagrams and visual analysis of various SEM packages' output.
Maintained by Sacha Epskamp. Last updated 3 years ago.
63 stars 10.64 score 2.1k scripts 13 dependentsr-spatial
leafgl:High-Performance 'WebGl' Rendering for Package 'leaflet'
Provides bindings to the 'Leaflet.glify' JavaScript library which extends the 'leaflet' JavaScript library to render large data in the browser using 'WebGl'.
Maintained by Tim Appelhans. Last updated 5 months ago.
271 stars 10.63 score 157 scripts 27 dependentsmerlinoa
shinyFeedback:Display User Feedback in Shiny Apps
Easily display user feedback in Shiny apps.
Maintained by Andy Merlino. Last updated 3 years ago.
191 stars 10.62 score 209 scripts 16 dependentshrbrmstr
waffle:Create Waffle Chart Visualizations
Square pie charts (a.k.a. waffle charts) can be used to communicate parts of a whole for categorical quantities. To emulate the percentage view of a pie chart, a 10x10 grid should be used with each square representing 1% of the total. Modern uses of waffle charts do not necessarily adhere to this rule and can be created with a grid of any rectangular shape. Best practices suggest keeping the number of categories small, just as should be done when creating pie charts. Tools are provided to create waffle charts as well as stitch them together, and to use glyphs for making isotype pictograms.
Maintained by Bob Rudis. Last updated 2 years ago.
data-visualisationdata-visualizationdatavisualizationggplot2square-pie-chartswaffle-charts
777 stars 10.62 score 1.3k scripts 5 dependentsbusiness-science
modeltime:The Tidymodels Extension for Time Series Modeling
The time series forecasting framework for use with the 'tidymodels' ecosystem. Models include ARIMA, Exponential Smoothing, and additional time series models from the 'forecast' and 'prophet' packages. Refer to "Forecasting Principles & Practice, Second edition" (<https://otexts.com/fpp2/>). Refer to "Prophet: forecasting at scale" (<https://research.facebook.com/blog/2017/02/prophet-forecasting-at-scale/>.).
Maintained by Matt Dancho. Last updated 5 months ago.
arimadata-sciencedeep-learningetsforecastingmachine-learningmachine-learning-algorithmsmodeltimeprophettbatstidymodelingtidymodelstimetime-seriestime-series-analysistimeseriestimeseries-forecasting
551 stars 10.61 score 1.1k scripts 7 dependentspredictiveecology
SpaDES.core:Core Utilities for Developing and Running Spatially Explicit Discrete Event Models
Provides the core framework for a discrete event system to implement a complete data-to-decisions, reproducible workflow. The core components facilitate the development of modular pieces, and enable the user to include additional functionality by running user-built modules. Includes conditional scheduling, restart after interruption, packaging of reusable modules, tools for developing arbitrary automated workflows, automated interweaving of modules of different temporal resolution, and tools for visualizing and understanding the within-project dependencies. The suggested package 'NLMR' can be installed from the repository (<https://PredictiveEcology.r-universe.dev>).
Maintained by Eliot J B McIntire. Last updated 1 months ago.
discrete-events-simulationssimulation-frameworksimulation-modeling
10 stars 10.61 score 142 scripts 6 dependentsbioc
Glimma:Interactive visualizations for gene expression analysis
This package produces interactive visualizations for RNA-seq data analysis, utilizing output from limma, edgeR, or DESeq2. It produces interactive htmlwidgets versions of popular RNA-seq analysis plots to enhance the exploration of analysis results by overlaying interactive features. The plots can be viewed in a web browser or embedded in notebook documents.
Maintained by Shian Su. Last updated 2 months ago.
differentialexpressiongeneexpressionmicroarrayreportwritingrnaseqsequencingvisualizationdifferential-expressioninteractive-visualizations
32 stars 10.58 score 600 scripts 1 dependentsbioc
ORFik:Open Reading Frames in Genomics
R package for analysis of transcript and translation features through manipulation of sequence data and NGS data like Ribo-Seq, RNA-Seq, TCP-Seq and CAGE. It is generalized in the sense that any transcript region can be analysed, as the name hints to it was made with investigation of ribosomal patterns over Open Reading Frames (ORFs) as it's primary use case. ORFik is extremely fast through use of C++, data.table and GenomicRanges. Package allows to reassign starts of the transcripts with the use of CAGE-Seq data, automatic shifting of RiboSeq reads, finding of Open Reading Frames for whole genomes and much more.
Maintained by Haakon Tjeldnes. Last updated 1 months ago.
immunooncologysoftwaresequencingriboseqrnaseqfunctionalgenomicscoveragealignmentdataimportcpp
33 stars 10.56 score 115 scripts 2 dependentsyulab-smu
ggfun:Miscellaneous Functions for 'ggplot2'
Useful functions and utilities for 'ggplot' object (e.g., geometric layers, themes, and utilities to edit the object).
Maintained by Guangchuang Yu. Last updated 14 days ago.
18 stars 10.53 score 58 scripts 152 dependentscaseyyoungflesh
MCMCvis:Tools to Visualize, Manipulate, and Summarize MCMC Output
Performs key functions for MCMC analysis using minimal code - visualizes, manipulates, and summarizes MCMC output. Functions support simple and straightforward subsetting of model parameters within the calls, and produce presentable and 'publication-ready' output. MCMC output may be derived from Bayesian model output fit with Stan, NIMBLE, JAGS, and other software.
Maintained by Casey Youngflesh. Last updated 4 months ago.
38 stars 10.52 score 1.8k scripts 5 dependentspredictiveecology
reproducible:Enhance Reproducibility of R Code
A collection of high-level, machine- and OS-independent tools for making reproducible and reusable content in R. The two workhorse functions are Cache() and prepInputs(). Cache() allows for nested caching, is robust to environments and objects with environments (like functions), and deals with some classes of file-backed R objects e.g., from terra and raster packages. Both functions have been developed to be foundational components of data retrieval and processing in continuous workflow situations. In both functions, efforts are made to make the first and subsequent calls of functions have the same result, but faster at subsequent times by way of checksums and digesting. Several features are still under development, including cloud storage of cached objects allowing for sharing between users. Several advanced options are available, see ?reproducibleOptions().
Maintained by Eliot J B McIntire. Last updated 2 months ago.
reproducibilityreproducible-research
41 stars 10.52 score 122 scripts 15 dependents