Showing 152 of total 152 results (show query)
jonthegeek
fecapi:'OpenFEC' 'API' Client
A client to interact with the 'OpenFEC' 'API' at <https://api.open.fec.gov/developers/>. The 'OpenFEC' 'API' provides programmatic access to campaign finance data stored by the Federal Election Commission.
Maintained by Jon Harmon. Last updated 11 months ago.
90.2 match 3 stars 2.48 score 1 scripts
cloudyr
googleComputeEngineR:R Interface with Google Compute Engine
Interact with the 'Google Compute Engine' API in R. Lets you create, start and stop instances in the 'Google Cloud'. Support for preconfigured instances, with templates for common R needs.
Maintained by Mark Edmondson. Last updated 1 days ago.
apicloud-computingcloudyrgoogle-cloudgoogleauthrlaunching-virtual-machines
17.1 match 152 stars 9.73 score 235 scripts
rstudio
keras3:R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks API. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both CPU and GPU devices.
Maintained by Tomasz Kalinowski. Last updated 4 days ago.
12.2 match 845 stars 13.57 score 264 scripts 2 dependents
whipson
maestro:Orchestration of Data Pipelines
Framework for creating and orchestrating data pipelines. Organize, orchestrate, and monitor multiple pipelines in a single project. Use tags to decorate functions with scheduling parameters and configuration.
Maintained by Will Hipson. Last updated 2 days ago.
18.0 match 117 stars 9.11 score 150 scripts
t-kalinowski
keras:R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks 'API'. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both 'CPU' and 'GPU' devices.
Maintained by Tomasz Kalinowski. Last updated 11 months ago.
14.4 match 10.82 score 10k scripts 54 dependents
bupaverse
edeaR:Exploratory and Descriptive Event-Based Data Analysis
Exploratory and descriptive analysis of event based data. Provides methods for describing and selecting process data, and for preparing event log data for process mining. Builds on the S3-class for event logs implemented in the package 'bupaR'.
Maintained by Gert Janssenswillen. Last updated 3 months ago.
15.9 match 12 stars 9.17 score 149 scripts 8 dependents
bnosac
cronR:Schedule R Scripts and Processes with the 'cron' Job Scheduler
Create, edit, and remove 'cron' jobs on your unix-alike system. The package provides a set of easy-to-use wrappers to 'crontab'. It also provides an RStudio add-in to easily launch and schedule your scripts.
Maintained by Jan Wijffels. Last updated 1 years ago.
18.7 match 291 stars 7.17 score 167 scripts
nflverse
nflreadr:Download 'nflverse' Data
A minimal package for downloading data from 'GitHub' repositories of the 'nflverse' project.
Maintained by Tan Ho. Last updated 4 months ago.
nflnflfastrnflversesports-data
9.2 match 66 stars 12.46 score 476 scripts 10 dependents
r-lib
later:Utilities for Scheduling Functions to Execute Later with Event Loops
Executes arbitrary R or C functions some time after the current time, after the R execution stack has emptied. The functions are scheduled in an event loop.
Maintained by Winston Chang. Last updated 1 months ago.
7.2 match 143 stars 15.86 score 234 scripts 2.6k dependents
dreamrs
toastui:Interactive Tables, Calendars and Charts for the Web
Create interactive tables, calendars and charts with 'TOAST UI' <https://ui.toast.com/> libraries to integrate in 'shiny' applications or 'rmarkdown' 'HTML' documents.
Maintained by Victor Perrier. Last updated 16 days ago.
10.1 match 86 stars 10.03 score 144 scripts 8 dependents
sportsdataverse
hoopR:Access Men's Basketball Play by Play Data
A utility to quickly obtain clean and tidy men's basketball play by play data. Provides functions to access live play by play and box score data from ESPN<https://www.espn.com> with shot locations when available. It is also a full NBA Stats API<https://www.nba.com/stats/> wrapper. It is also a scraping and aggregating interface for Ken Pomeroy's men's college basketball statistics website<https://kenpom.com>. It provides users with an active subscription the capability to scrape the website tables and analyze the data for themselves.
Maintained by Saiem Gilani. Last updated 1 years ago.
basketballcollege-basketballespnkenpomnbanba-analyticsnba-apinba-datanba-statisticsnba-statsnba-stats-apincaancaa-basketballncaa-bracketncaa-playersncaa-ratingsncaamsportsdataverse
14.2 match 91 stars 6.93 score 261 scripts
mschubert
clustermq:Evaluate Function Calls on HPC Schedulers (LSF, SGE, SLURM, PBS/Torque)
Evaluate arbitrary function calls using workers on HPC schedulers in single line of code. All processing is done on the network without accessing the file system. Remote schedulers are supported via SSH.
Maintained by Michael Schubert. Last updated 25 days ago.
clusterhigh-performance-computinglsfsgeslurmsshzeromq3cpp
7.9 match 149 stars 10.23 score 253 scripts
mmiche
esmprep:Data Preparation During and After the Use of the Experience Sampling Methodology (ESM)
Support in preparing a raw ESM dataset for statistical analysis. Preparation includes the handling of errors (mostly due to technological reasons) and the generating of new variables that are necessary and/or helpful in meeting the conditions when statistically analyzing ESM data. The functions in 'esmprep' are meant to hierarchically lead from bottom, i.e. the raw (separated) ESM dataset(s), to top, i.e. a single ESM dataset ready for statistical analysis. This hierarchy evolved out of my personal experience in working with ESM data.
Maintained by Marcel Miché. Last updated 6 years ago.
19.4 match 4 stars 3.99 score 49 scripts
billpetti
baseballr:Acquiring and Analyzing Baseball Data
Provides numerous utilities for acquiring and analyzing baseball data from online sources such as 'Baseball Reference' <https://www.baseball-reference.com/>, 'FanGraphs' <https://www.fangraphs.com/>, and the 'MLB Stats' API <https://www.mlb.com/>.
Maintained by Saiem Gilani. Last updated 4 months ago.
baseballpitchfxsabermetricsstatcast
7.0 match 380 stars 8.98 score 582 scripts
stewid
SimInf:A Framework for Data-Driven Stochastic Disease Spread Simulations
Provides an efficient and very flexible framework to conduct data-driven epidemiological modeling in realistic large scale disease spread simulations. The framework integrates infection dynamics in subpopulations as continuous-time Markov chains using the Gillespie stochastic simulation algorithm and incorporates available data such as births, deaths and movements as scheduled events at predefined time-points. Using C code for the numerical solvers and 'OpenMP' (if available) to divide work over multiple processors ensures high performance when simulating a sample outcome. One of our design goals was to make the package extendable and enable usage of the numerical solvers from other R extension packages in order to facilitate complex epidemiological research. The package contains template models and can be extended with user-defined models. For more details see the paper by Widgren, Bauer, Eriksson and Engblom (2019) <doi:10.18637/jss.v091.i12>. The package also provides functionality to fit models to time series data using the Approximate Bayesian Computation Sequential Monte Carlo ('ABC-SMC') algorithm of Toni and others (2009) <doi:10.1098/rsif.2008.0172>.
Maintained by Stefan Widgren. Last updated 5 days ago.
data-drivenepidemiologyhigh-performance-computingmarkov-chainmathematical-modellinggslopenmp
6.1 match 35 stars 10.09 score 227 scripts
bioc
BiocParallel:Bioconductor facilities for parallel evaluation
This package provides modified versions and novel implementation of functions for parallel evaluation, tailored to use with Bioconductor objects.
Maintained by Martin Morgan. Last updated 26 days ago.
infrastructurebioconductor-packagecore-packageu24ca289073cpp
3.4 match 67 stars 17.40 score 7.3k scripts 1.1k dependents
mlverse
torch:Tensors and Neural Networks with 'GPU' Acceleration
Provides functionality to define and train neural networks similar to 'PyTorch' by Paszke et al (2019) <doi:10.48550/arXiv.1912.01703> but written entirely in R using the 'libtorch' library. Also supports low-level tensor operations and 'GPU' acceleration.
Maintained by Daniel Falbel. Last updated 6 days ago.
3.5 match 520 stars 16.52 score 1.4k scripts 38 dependents
sthonnard
ssimparser:Standard Schedules Information Parser
Parse Standard Schedules Information file (types 2 and 3) into a Data Frame. Can also expand schedules into flights.
Maintained by Sebastien Thonnard. Last updated 3 years ago.
15.7 match 10 stars 3.70 score 1 scripts
r-simmer
simmer:Discrete-Event Simulation for R
A process-oriented and trajectory-based Discrete-Event Simulation (DES) package for R. It is designed as a generic yet powerful framework. The architecture encloses a robust and fast simulation core written in 'C++' with automatic monitoring capabilities. It provides a rich and flexible R API that revolves around the concept of trajectory, a common path in the simulation model for entities of the same type. Documentation about 'simmer' is provided by several vignettes included in this package, via the paper by Ucar, Smeets & Azcorra (2019, <doi:10.18637/jss.v090.i02>), and the paper by Ucar, Hernández, Serrano & Azcorra (2018, <doi:10.1109/MCOM.2018.1700960>); see 'citation("simmer")' for details.
Maintained by Iñaki Ucar. Last updated 6 months ago.
5.0 match 223 stars 11.47 score 440 scripts 6 dependents
mrc-ide
monty:Monte Carlo Models
Experimental sources for the next generation of mcstate, now called 'monty', which will support much of the old mcstate functionality but new things like better parameter interfaces, Hamiltonian Monte Carlo, and other features.
Maintained by Rich FitzJohn. Last updated 1 months ago.
7.3 match 3 stars 7.52 score 29 scripts 3 dependents
vusaverse
vvtermtime:Interface for 'Semestry TermTime' Services
Provides an R interface for interacting with the 'Semestry TermTime' services. It allows users to retrieve scheduling data from the API. see <https://github.com/vusaverse/vvtermtime/blob/main/openapi_7.7.0.pdf> for details.
Maintained by Tomer Iwan. Last updated 10 months ago.
schedulingsemestrytermtimetimetables
14.0 match 3.70 score 5 scripts
ddalthorp
GenEst:Generalized Mortality Estimator
Command-line and 'shiny' GUI implementation of the GenEst models for estimating bird and bat mortality at wind and solar power facilities, following Dalthorp, et al. (2018) <doi:10.3133/tm7A2>.
Maintained by Daniel Dalthorp. Last updated 2 years ago.
6.3 match 7 stars 7.81 score 55 scripts 2 dependents
guyabel
migest:Methods for the Indirect Estimation of Bilateral Migration
Tools for estimating, measuring and working with migration data.
Maintained by Guy J. Abel. Last updated 1 months ago.
8.5 match 32 stars 5.80 score 86 scripts
subramv
cms:Calculate Medicare Reimbursement
Uses the 'CMS' application programming interface <https://dnav.cms.gov/api/healthdata> to provide users databases containing yearly Medicare reimbursement rates in the United States. Data can be acquired for the entire United States or only for specific localities. Currently, support is only provided for the Medicare Physician Fee Schedule, but support will be expanded for other 'CMS' databases in future versions.
Maintained by Vigneshwar Subramanian. Last updated 4 years ago.
medicaremedicare-datareimbursement
10.6 match 7 stars 4.54 score 10 scriptsrstudio
shiny:Web Application Framework for R
Makes it incredibly easy to build interactive web applications with R. Automatic "reactive" binding between inputs and outputs and extensive prebuilt widgets make it possible to build beautiful, responsive, and powerful applications with minimal effort.
Maintained by Winston Chang. Last updated 13 days ago.
reactiverstudioshinyweb-appweb-development
2.3 match 5.4k stars 21.28 score 108k scripts 1.8k dependentssportsdataverse
wehoop:Access Women's Basketball Play by Play Data
A utility for working with women's basketball data. A scraping and aggregating interface for the WNBA Stats API <https://stats.wnba.com/> and ESPN's <https://www.espn.com> women's college basketball and WNBA statistics. It provides users with the capability to access the game play-by-plays, box scores, standings and results to analyze the data for themselves.
Maintained by Saiem Gilani. Last updated 8 months ago.
college-basketballespnespn-statsncaancaa-basketballprofessional-basketball-datasportsdataversewnbawnba-playerswnba-statswomens-basketball
8.8 match 28 stars 5.36 score 54 scripts
predictiveecology
SpaDES.core:Core Utilities for Developing and Running Spatially Explicit Discrete Event Models
Provides the core framework for a discrete event system to implement a complete data-to-decisions, reproducible workflow. The core components facilitate the development of modular pieces, and enable the user to include additional functionality by running user-built modules. Includes conditional scheduling, restart after interruption, packaging of reusable modules, tools for developing arbitrary automated workflows, automated interweaving of modules of different temporal resolution, and tools for visualizing and understanding the within-project dependencies. The suggested package 'NLMR' can be installed from the repository (<https://PredictiveEcology.r-universe.dev>).
Maintained by Eliot J B McIntire. Last updated 19 days ago.
discrete-events-simulationssimulation-frameworksimulation-modeling
4.4 match 10 stars 10.61 score 142 scripts 6 dependents
poissonconsulting
ypr:Yield Per Recruit
An implementation of equilibrium-based yield per recruit methods. Yield per recruit methods can used to estimate the optimal yield for a fish population as described by Walters and Martell (2004) <isbn:0-691-11544-3>. The yield can be based on the number of fish caught (or harvested) or biomass caught for all fish or just large (trophy) individuals.
Maintained by Joe Thorley. Last updated 2 months ago.
5.8 match 7 stars 7.84 score 55 scripts 1 dependents
r-transit
tidytransit:Read, Validate, Analyze, and Map GTFS Feeds
Read General Transit Feed Specification (GTFS) zipfiles into a list of R dataframes. Perform validation of the data structure against the specification. Analyze the headways and frequencies at routes and stops. Create maps and perform spatial analysis on the routes and stops. Please see the GTFS documentation here for more detail: <https://gtfs.org/>.
Maintained by Flavio Poletti. Last updated 1 months ago.
gtfspublicpublic-transporttidyversetransittransit-datatransporttransportation
4.3 match 151 stars 10.47 score 272 scripts 1 dependents
eddelbuettel
RQuantLib:R Interface to the 'QuantLib' Library
The 'RQuantLib' package makes parts of 'QuantLib' accessible from R The 'QuantLib' project aims to provide a comprehensive software framework for quantitative finance. The goal is to provide a standard open source library for quantitative analysis, modeling, trading, and risk management of financial assets.
Maintained by Dirk Eddelbuettel. Last updated 2 months ago.
5.3 match 123 stars 8.52 score 194 scripts
posit-dev
connectapi:Utilities for Interacting with the 'Posit Connect' Server API
Provides a helpful 'R6' class and methods for interacting with the 'Posit Connect' Server API along with some meaningful utility functions for regular tasks. API documentation varies by 'Posit Connect' installation and version, but the latest documentation is also hosted publicly at <https://docs.posit.co/connect/api/>.
Maintained by Toph Allen. Last updated 3 days ago.
4.3 match 47 stars 10.48 score 252 scripts 1 dependents
carpentries
sandpaper:Create and Curate Carpentries Lessons
We provide tools to build a Carpentries-themed lesson repository into an accessible standalone static website. These include local tools and those designed to be used in a continuous integration context so that all the lesson author needs to focus on is writing the content of the actual lesson.
Maintained by Robert Davey. Last updated 2 months ago.
carpentriescarpentries-infrastructurecarpentries-workbenchlesson-templatelessonsmarkdownstatic-site-generator
5.7 match 44 stars 7.72 score 8 scripts
tlverse
delayed:A Framework for Parallelizing Dependent Tasks
Mechanisms to parallelize dependent tasks in a manner that optimizes the compute resources available. It provides access to "delayed" computations, which may be parallelized using futures. It is, to an extent, a facsimile of the 'Dask' library (<https://www.dask.org/>), for the 'Python' language.
Maintained by Jeremy Coyle. Last updated 11 months ago.
6.2 match 23 stars 7.03 score 39 scripts 8 dependents
jessieyeung
rcbayes:Estimate Rogers-Castro Migration Age Schedules with Bayesian Models
A collection of functions to estimate Rogers-Castro migration age schedules using 'Stan'. This model which describes the fundamental relationship between migration and age in the form of a flexible multi-exponential migration model was most notably proposed in Rogers and Castro (1978) <doi:10.1068/a100475>.
Maintained by Jessie Yeung. Last updated 1 years ago.
9.2 match 2 stars 4.60 score 8 scripts
pkrog
sched:Request Scheduler
Offers classes and functions to contact web servers while enforcing scheduling rules required by the sites. The URL class makes it easy to construct a URL by providing parameters as a vector. The Request class allows to describes SOAP (Simple Object Access Protocol) or standard requests: URL, method (POST or GET), header, body. The Scheduler class controls the request frequency for each server address by mean of rules (Rule class). The RequestResult class permits to get the request status to handle error cases and the content.
Maintained by Pierrick Roger. Last updated 6 months ago.
14.9 match 2.78 score 2 scripts
ffverse
ffsimulator:Simulate Fantasy Football Seasons
Uses bootstrap resampling to run fantasy football season simulations supported by historical rankings and 'nflfastR' data, calculating optimal lineups, and returning aggregated results.
Maintained by Tan Ho. Last updated 5 months ago.
7.8 match 17 stars 5.17 score 44 scripts
metrumresearchgroup
mrgsolve:Simulate from ODE-Based Models
Fast simulation from ordinary differential equation (ODE) based models typically employed in quantitative pharmacology and systems biology.
Maintained by Kyle T Baron. Last updated 1 months ago.
3.7 match 138 stars 10.90 score 1.2k scripts 3 dependents
citoverse
cito:Building and Training Neural Networks
The 'cito' package provides a user-friendly interface for training and interpreting deep neural networks (DNN). 'cito' simplifies the fitting of DNNs by supporting the familiar formula syntax, hyperparameter tuning under cross-validation, and helps to detect and handle convergence problems. DNNs can be trained on CPU, GPU and MacOS GPUs. In addition, 'cito' has many downstream functionalities such as various explainable AI (xAI) metrics (e.g. variable importance, partial dependence plots, accumulated local effect plots, and effect estimates) to interpret trained DNNs. 'cito' optionally provides confidence intervals (and p-values) for all xAI metrics and predictions. At the same time, 'cito' is computationally efficient because it is based on the deep learning framework 'torch'. The 'torch' package is native to R, so no Python installation or other API is required for this package.
Maintained by Maximilian Pichler. Last updated 2 months ago.
machine-learningneural-network
4.3 match 42 stars 9.07 score 129 scripts 1 dependents
ropensci
drake:A Pipeline Toolkit for Reproducible Computation at Scale
A general-purpose computational engine for data analysis, drake rebuilds intermediate data objects when their dependencies change, and it skips work when the results are already up to date. Not every execution starts from scratch, there is native support for parallel and distributed computing, and completed projects have tangible evidence that they are reproducible. Extensive documentation, from beginner-friendly tutorials to practical examples and more, is available at the reference website <https://docs.ropensci.org/drake/> and the online manual <https://books.ropensci.org/drake/>.
Maintained by William Michael Landau. Last updated 3 months ago.
data-sciencedrakehigh-performance-computingmakefilepeer-reviewedpipelinereproducibilityreproducible-researchropensciworkflow
3.3 match 1.3k stars 11.49 score 1.7k scripts 1 dependents
david-hammond
pmev:Calculates Earned Value for a Project Schedule
Given a project schedule and associated costs, this package calculates the earned value to date. It is an implementation of Project Management Body of Knowledge (PMBOK) methodologies (reference Project Management Institute. (2021). A guide to the Project Management Body of Knowledge (PMBOK guide) (7th ed.). Project Management Institute, Newtown Square, PA, ISBN 9781628256673 (pdf)).
Maintained by David Hammond. Last updated 7 months ago.
10.9 match 3.30 score 4 scripts
kjhealy
gssrdoc:Document General Social Survey Variable
The General Social Survey (GSS) is a long-running, mostly annual survey of US households. It is administered by the National Opinion Research Center (NORC). This package contains the a tibble with information on the survey variables, together with every variable documented as an R help page. For more information on the GSS see \url{http://gss.norc.org}.
Maintained by Kieran Healy. Last updated 11 months ago.
15.5 match 2.28 score 38 scripts
bbecker-bayer
interim:Scheduling Interim Analyses in Clinical Trials
Allows the simulation of the recruitment and both the event and treatment phase of a clinical trial. Based on these simulations, the timing of interim analyses can be assessed.
Maintained by Bastian Becker. Last updated 6 years ago.
22.5 match 1.48 score 7 scripts 1 dependents
jiefei-wang
aws.ecx:Communicating with AWS EC2 and ECS using AWS REST APIs
Providing the functions for communicating with Amazon Web Services(AWS) Elastic Compute Cloud(EC2) and Elastic Container Service(ECS). The functions will have the prefix 'ecs_' or 'ec2_' depending on the class of the API. The request will be sent via the REST API and the parameters are given by the function argument. The credentials can be set via 'aws_set_credentials'. The EC2 documentation can be found at <https://docs.aws.amazon.com/AWSEC2/latest/APIReference/Welcome.html> and ECS can be found at <https://docs.aws.amazon.com/AmazonECS/latest/APIReference/Welcome.html>.
Maintained by Jiefei Wang. Last updated 3 years ago.
7.9 match 1 stars 4.18 score 2 scripts
civisanalytics
civis:R Client for the 'Civis Platform API'
A convenient interface for making requests directly to the 'Civis Platform API' <https://www.civisanalytics.com/platform/>. Full documentation available 'here' <https://civisanalytics.github.io/civis-r/>.
Maintained by Peter Cooman. Last updated 2 months ago.
3.9 match 16 stars 7.84 score 144 scripts
blue-matter
openMSE:Easily Install and Load the 'openMSE' Packages
The 'openMSE' package is designed for building operating models, doing simulation modelling and management strategy evaluation for fisheries. 'openMSE' is an umbrella package for the 'MSEtool' (Management Strategy Evaluation toolkit), 'DLMtool' (Data-Limited Methods toolkit), and SAMtool (Stock Assessment Methods toolkit) packages. By loading and installing 'openMSE', users have access to the full functionality contained within these packages. Learn more about 'openMSE' at <https://openmse.com/>.
Maintained by Adrian Hordyk. Last updated 6 months ago.
5.4 match 14 stars 5.57 score 89 scripts
atfutures
calendar:Create, Read, Write, and Work with 'iCalendar' Files, Calendars and Scheduling Data
Provides function to create, read, write, and work with 'iCalendar' files (which typically have '.ics' or '.ical' extensions), and the scheduling data, calendars and timelines of people, organisations and other entities that they represent. 'iCalendar' is an open standard for exchanging calendar and scheduling information between users and computers, described at <https://icalendar.org/>.
Maintained by Robin Lovelace. Last updated 7 months ago.
3.6 match 42 stars 8.33 score 113 scripts 1 dependentsr-lib
ymlthis:Write 'YAML' for 'R Markdown', 'bookdown', 'blogdown', and More
Write 'YAML' front matter for R Markdown and related documents. Work with 'YAML' objects more naturally and write the resulting 'YAML' to your clipboard or to 'YAML' files related to your project.
Maintained by Malcolm Barrett. Last updated 3 years ago.
3.0 match 165 stars 9.91 score 196 scripts 14 dependentsbioc
biodb:biodb, a library and a development framework for connecting to chemical and biological databases
The biodb package provides access to standard remote chemical and biological databases (ChEBI, KEGG, HMDB, ...), as well as to in-house local database files (CSV, SQLite), with easy retrieval of entries, access to web services, search of compounds by mass and/or name, and mass spectra matching for LCMS and MSMS. Its architecture as a development framework facilitates the development of new database connectors for local projects or inside separate published packages.
Maintained by Pierrick Roger. Last updated 5 months ago.
softwareinfrastructuredataimportkeggbiologycheminformaticschemistrydatabasescpp
3.5 match 11 stars 7.85 score 24 scripts 6 dependents
cran
capitalR:Capital Budgeting Analysis, Annuity Loan Calculations and Amortization Schedules
Provides Capital Budgeting Analysis functionality and the essential Annuity loan functions. Also computes Loan Amortization Schedules including schedules with irregular payments.
Maintained by John T. Buynak. Last updated 5 years ago.
13.5 match 2.00 score
topepo
AppliedPredictiveModeling:Functions and Data Sets for 'Applied Predictive Modeling'
A few functions and several data set for the Springer book 'Applied Predictive Modeling'.
Maintained by Max Kuhn. Last updated 2 years ago.
3.8 match 37 stars 6.89 score 1.2k scripts
jozefhajnala
nhlapi:A Minimum-Dependency 'R' Interface to the 'NHL' API
Retrieves and processes the data exposed by the open 'NHL' API. This includes information on players, teams, games, tournaments, drafts, standings, schedules and other endpoints. A lower-level interface to access the data via URLs directly is also provided.
Maintained by Jozef Hajnala. Last updated 4 years ago.
4.1 match 29 stars 6.00 score 23 scripts
bodkan
slendr:A Simulation Framework for Spatiotemporal Population Genetics
A framework for simulating spatially explicit genomic data which leverages real cartographic information for programmatic and visual encoding of spatiotemporal population dynamics on real geographic landscapes. Population genetic models are then automatically executed by the 'SLiM' software by Haller et al. (2019) <doi:10.1093/molbev/msy228> behind the scenes, using a custom built-in simulation 'SLiM' script. Additionally, fully abstract spatial models not tied to a specific geographic location are supported, and users can also simulate data from standard, non-spatial, random-mating models. These can be simulated either with the 'SLiM' built-in back-end script, or using an efficient coalescent population genetics simulator 'msprime' by Baumdicker et al. (2022) <doi:10.1093/genetics/iyab229> with a custom-built 'Python' script bundled with the R package. Simulated genomic data is saved in a tree-sequence format and can be loaded, manipulated, and summarised using tree-sequence functionality via an R interface to the 'Python' module 'tskit' by Kelleher et al. (2019) <doi:10.1038/s41588-019-0483-y>. Complete model configuration, simulation and analysis pipelines can be therefore constructed without a need to leave the R environment, eliminating friction between disparate tools for population genetic simulations and data analysis.
Maintained by Martin Petr. Last updated 12 days ago.
popgenpopulation-geneticssimulationsspatial-statistics
2.6 match 56 stars 9.15 score 88 scripts
nhs-r-community
NHSRwaitinglist:R-package to implement a waiting list management approach
R-package to implement the waiting list management approach described in this paper by Fong et al 2022.
Maintained by Tom Smith. Last updated 4 months ago.
3.9 match 16 stars 6.06 score 17 scripts
tidymodels
dials:Tools for Creating Tuning Parameter Values
Many models contain tuning parameters (i.e. parameters that cannot be directly estimated from the data). These tools can be used to define objects for creating, simulating, or validating values for such parameters.
Maintained by Hannah Frick. Last updated 30 days ago.
1.6 match 114 stars 14.31 score 426 scripts 52 dependents
bedapub
designit:Blocking and Randomization for Experimental Design
Intelligently assign samples to batches in order to reduce batch effects. Batch effects can have a significant impact on data analysis, especially when the assignment of samples to batches coincides with the contrast groups being studied. By defining a batch container and a scoring function that reflects the contrasts, this package allows users to assign samples in a way that minimizes the potential impact of batch effects on the comparison of interest. Among other functionality, we provide an implementation for OSAT score by Yan et al. (2012, <doi:10.1186/1471-2164-13-689>).
Maintained by Iakov I. Davydov. Last updated 4 months ago.
design-of-experimentsrandomization
3.1 match 8 stars 7.28 score 24 scripts
traitecoevo
plant:A Package for Modelling Forest Trait Ecology and Evolution
Solves trait, size and patch structured model from (Falster et al. 2016) using either method of characteristics or as stochastic, finite-sized population.
Maintained by Daniel Falster. Last updated 7 days ago.
c-plus-plusdemographydynamicecologyevolutionforestsplant-physiologyscience-researchsimulationtraitcpp
3.9 match 53 stars 5.87 score
paulgovan
PRA:Project Risk Analysis
Data analysis for Project Risk Management via the Second Moment Method, Monte Carlo Simulation, Contingency Analysis, Sensitivity Analysis, Earned Value Management, Learning Curves, Design Structure Matrices, and more.
Maintained by Paul Govan. Last updated 3 months ago.
causal-networkscontingency-analysismonte-carlo-simulationrisk-analysissensitivity-analysis
3.9 match 3 stars 5.82 score 8 scripts
paws-r
paws:Amazon Web Services Software Development Kit
Interface to Amazon Web Services <https://aws.amazon.com>, including storage, database, and compute services, such as 'Simple Storage Service' ('S3'), 'DynamoDB' 'NoSQL' database, and 'Lambda' functions-as-a-service.
Maintained by Dyfan Jones. Last updated 3 days ago.
2.0 match 332 stars 11.25 score 177 scripts 12 dependents
michaelhallquist
MplusAutomation:An R Package for Facilitating Large-Scale Latent Variable Analyses in Mplus
Leverages the R language to automate latent variable model estimation and interpretation using 'Mplus', a powerful latent variable modeling program developed by Muthen and Muthen (<https://www.statmodel.com>). Specifically, this package provides routines for creating related groups of models, running batches of models, and extracting and tabulating model parameters and fit statistics.
Maintained by Michael Hallquist. Last updated 2 months ago.
1.7 match 86 stars 12.96 score 664 scripts 13 dependents
avi-kenny
SimEngine:A Modular Framework for Statistical Simulations in R
An open-source R package for structuring, maintaining, running, and debugging statistical simulations on both local and cluster-based computing environments.See full documentation at <https://avi-kenny.github.io/SimEngine/>.
Maintained by Avi Kenny. Last updated 23 days ago.
3.0 match 12 stars 7.18 score 50 scripts
mlr-org
mlr3hyperband:Hyperband for 'mlr3'
Successive Halving (Jamieson and Talwalkar (2016) <doi:10.48550/arXiv.1502.07943>) and Hyperband (Li et al. 2018 <doi:10.48550/arXiv.1603.06560>) optimization algorithm for the mlr3 ecosystem. The implementation in mlr3hyperband features improved scheduling and parallelizes the evaluation of configurations. The package includes tuners for hyperparameter optimization in mlr3tuning and optimizers for black-box optimization in bbotk.
Maintained by Marc Becker. Last updated 9 months ago.
automlbbotkhyperbandhyperparameter-tuningmachine-learningmlr3optimizationtunetuning
2.8 match 18 stars 7.48 score 44 scripts 3 dependents
windwill
cascsim:Casualty Actuarial Society Individual Claim Simulator
It is an open source insurance claim simulation engine sponsored by the Casualty Actuarial Society. It generates individual insurance claims including open claims, reopened claims, incurred but not reported claims and future claims. It also includes claim data fitting functions to help set simulation assumptions. It is useful for claim level reserving analysis. Parodi (2013) <https://www.actuaries.org.uk/documents/triangle-free-reserving-non-traditional-framework-estimating-reserves-and-reserve-uncertainty>.
Maintained by Kailan Shang. Last updated 5 years ago.
6.8 match 2.99 score 98 scripts
mrc-ide
rrq:Simple Redis Queue
Simple Redis queue in R.
Maintained by Rich FitzJohn. Last updated 4 months ago.
2.6 match 24 stars 7.40 score 14 scripts 3 dependentsnflverse
nflfastR:Functions to Efficiently Access NFL Play by Play Data
A set of functions to access National Football League play-by-play data from <https://www.nfl.com/>.
Maintained by Ben Baldwin. Last updated 2 months ago.
american-footballfootball-datanflnflstatsnflversesports-analytics
1.9 match 442 stars 10.40 score 596 scripts 3 dependents
saviviro
sstvars:Toolkit for Reduced Form and Structural Smooth Transition Vector Autoregressive Models
Penalized and non-penalized maximum likelihood estimation of smooth transition vector autoregressive models with various types of transition weight functions, conditional distributions, and identification methods. Constrained estimation with various types of constraints is available. Residual based model diagnostics, forecasting, simulations, and calculation of impulse response functions, generalized impulse response functions, and generalized forecast error variance decompositions. See Heather Anderson, Farshid Vahid (1998) <doi:10.1016/S0304-4076(97)00076-6>, Helmut Lütkepohl, Aleksei Netšunajev (2017) <doi:10.1016/j.jedc.2017.09.001>, Markku Lanne, Savi Virolainen (2025) <doi:10.48550/arXiv.2403.14216>, Savi Virolainen (2025) <doi:10.48550/arXiv.2404.19707>.
Maintained by Savi Virolainen. Last updated 17 days ago.
3.0 match 4 stars 6.36 score 41 scripts
eagerai
tfaddons:Interface to 'TensorFlow SIG Addons'
'TensorFlow SIG Addons' <https://www.tensorflow.org/addons> is a repository of community contributions that conform to well-established API patterns, but implement new functionality not available in core 'TensorFlow'. 'TensorFlow' natively supports a large number of operators, layers, metrics, losses, optimizers, and more. However, in a fast moving field like Machine Learning, there are many interesting new developments that cannot be integrated into core 'TensorFlow' (because their broad applicability is not yet clear, or it is mostly used by a smaller subset of the community).
Maintained by Turgut Abdullayev. Last updated 3 years ago.
deep-learningkerasneural-networkstensorflowtensorflow-addonstfa
3.7 match 20 stars 5.20 score 16 scriptsmlverse
luz:Higher Level 'API' for 'torch'
A high level interface for 'torch' providing utilities to reduce the the amount of code needed for common tasks, abstract away torch details and make the same code work on both the 'CPU' and 'GPU'. It's flexible enough to support expressing a large range of models. It's heavily inspired by 'fastai' by Howard et al. (2020) <arXiv:2002.04688>, 'Keras' by Chollet et al. (2015) and 'PyTorch Lightning' by Falcon et al. (2019) <doi:10.5281/zenodo.3828935>.
Maintained by Daniel Falbel. Last updated 6 months ago.
1.9 match 89 stars 9.86 score 318 scripts 4 dependentsrstudio
blastula:Easily Send HTML Email Messages
Compose and send out responsive HTML email messages that render perfectly across a range of email clients and device sizes. Helper functions let the user insert embedded images, web link buttons, and 'ggplot2' plot objects into the message body. Messages can be sent through an 'SMTP' server, through the 'Posit Connect' service, or through the 'Mailgun' API service <https://www.mailgun.com/>.
Maintained by Richard Iannone. Last updated 8 months ago.
easy-to-useemailhtmlmarkdownresponsive-emailsmtp
1.8 match 552 stars 10.27 score 348 scripts 5 dependents
ncsoft
promotionImpact:Analysis & Measurement of Promotion Effectiveness
Analysis and measurement of promotion effectiveness on a given target variable (e.g. daily sales). After converting promotion schedule into dummy or smoothed predictor variables, the package estimates the effects of these variables controlled for trend/periodicity/structural change using prophet by Taylor and Letham (2017) <doi:10.7287/peerj.preprints.3190v2> and some prespecified variables (e.g. start of a month).
Maintained by Nahyun Kim. Last updated 5 years ago.
5.0 match 47 stars 3.67 score 2 scriptsffverse
ffscrapr:API Client for Fantasy Football League Platforms
Helps access various Fantasy Football APIs by handling authentication and rate-limiting, forming appropriate calls, and returning tidy dataframes which can be easily connected to other data sources.
Maintained by Tan Ho. Last updated 5 months ago.
api-clientfantasy-footballfantasy-football-api
2.3 match 84 stars 8.07 score 178 scripts 1 dependentspaws-r
paws.application.integration:'Amazon Web Services' Application Integration Services
Interface to 'Amazon Web Services' application integration services, including 'Simple Queue Service' ('SQS') message queue, 'Simple Notification Service' ('SNS') publish/subscribe messaging, and more <https://aws.amazon.com/>.
Maintained by Dyfan Jones. Last updated 3 days ago.
2.0 match 332 stars 9.06 score 14 dependents
scasanova
f1dataR:Access Formula 1 Data
Obtain Formula 1 data via the 'Jolpica API' <https://jolpi.ca> and the unofficial API <https://www.formula1.com/en/timing/f1-live> via the 'fastf1' 'Python' library <https://docs.fastf1.dev/>.
Maintained by Santiago Casanova. Last updated 15 days ago.
2.3 match 58 stars 7.96 score 26 scripts
insightsengineering
random.cdisc.data:Create Random ADaM Datasets
A set of functions to create random Analysis Data Model (ADaM) datasets and cached dataset. ADaM dataset specifications are described by the Clinical Data Interchange Standards Consortium (CDISC) Analysis Data Model Team.
Maintained by Joe Zhu. Last updated 5 months ago.
2.0 match 33 stars 8.60 score 52 scriptsropensci
tidyhydat:Extract and Tidy Canadian 'Hydrometric' Data
Provides functions to access historical and real-time national 'hydrometric' data from Water Survey of Canada data sources (<https://dd.weather.gc.ca/hydrometric/csv/> and <https://collaboration.cmc.ec.gc.ca/cmc/hydrometrics/www/>) and then applies tidy data principles.
Maintained by Sam Albers. Last updated 5 days ago.
citzgovernment-datahydrologyhydrometricstidy-datawater-resources
1.8 match 71 stars 9.59 score 202 scripts 3 dependents
hanase
bayesPop:Probabilistic Population Projection
Generating population projections for all countries of the world using several probabilistic components, such as total fertility rate and life expectancy (Raftery et al., 2012 <doi:10.1073/pnas.1211452109>).
Maintained by Hana Sevcikova. Last updated 23 days ago.
7.4 match 2.15 score 44 scripts
dipterix
dipsaus:A Dipping Sauce for Data Analysis and Visualizations
Works as an "add-on" to packages like 'shiny', 'future', as well as 'rlang', and provides utility functions. Just like dipping sauce adding flavors to potato chips or pita bread, 'dipsaus' for data analysis and visualizations adds handy functions and enhancements to popular packages. The goal is to provide simple solutions that are frequently asked for online, such as how to synchronize 'shiny' inputs without freezing the app, or how to get memory size on 'Linux' or 'MacOS' system. The enhancements roughly fall into these four categories: 1. 'shiny' input widgets; 2. high-performance computing using the 'future' package; 3. modify R calls and convert among numbers, strings, and other objects. 4. utility functions to get system information such like CPU chip-set, memory limit, etc.
Maintained by Zhengjia Wang. Last updated 5 days ago.
2.0 match 13 stars 7.90 score 85 scripts 3 dependents
mountainmath
cansim:Accessing Statistics Canada Data Table and Vectors
Searches for, accesses, and retrieves Statistics Canada data tables, as well as individual vectors, as tidy data frames. This package enriches the tables with metadata, deals with encoding issues, allows for bilingual English or French language data retrieval, and bundles convenience functions to make it easier to work with retrieved table data. For more efficient data access the package allows for caching data in a local database and database level filtering, data manipulation and summarizing.
Maintained by Jens von Bergmann. Last updated 2 days ago.
1.8 match 45 stars 8.78 score 446 scripts
earthlab
rslurm:Submit R Calculations to a 'Slurm' Cluster
Functions that simplify submitting R scripts to a 'Slurm' workload manager, in part by automating the division of embarrassingly parallel calculations across cluster nodes.
Maintained by Erick Verleye. Last updated 2 years ago.
1.9 match 55 stars 8.30 score 303 scripts 1 dependents
oobianom
quickcode:Quick and Essential 'R' Tricks for Better Scripts
The NOT functions, 'R' tricks and a compilation of some simple quick plus often used 'R' codes to improve your scripts. Improve the quality and reproducibility of 'R' scripts.
Maintained by Obinna Obianom. Last updated 14 days ago.
2.0 match 5 stars 7.76 score 7 scripts 6 dependents
k5cents
metro:Washington Metropolitan Area Transit Authority API
The Washington Metropolitan Area Transit Authority is a government agency operating light rail and passenger buses in the Washington D.C. area. With a free developer account, access their 'Metro Transparent Data Sets API' <https://developer.wmata.com/> to return data frames of transit data for easy analysis.
Maintained by Kiernan Nicholls. Last updated 1 years ago.
metropublic-transportationtransit-datawashington-dcwmatawmata-api
4.3 match 4 stars 3.60 score 7 scripts
davisvaughan
almanac:Tools for Working with Recurrence Rules
Provides tools for defining recurrence rules and recurrence sets. Recurrence rules are a programmatic way to define a recurring event, like the first Monday of December. Multiple recurrence rules can be combined into larger recurrence sets. A full holiday and calendar interface is also provided that can generate holidays within a particular year, can detect if a date is a holiday, can respect holiday observance rules, and allows for custom holidays.
Maintained by Davis Vaughan. Last updated 2 years ago.
calendarsholidaysrecurrence-rules
1.8 match 73 stars 8.40 score 65 scripts 1 dependentsmlr-org
mlr3torch:Deep Learning with 'mlr3'
Deep Learning library that extends the mlr3 framework by building upon the 'torch' package. It allows to conveniently build, train, and evaluate deep learning models without having to worry about low level details. Custom architectures can be created using the graph language defined in 'mlr3pipelines'.
Maintained by Sebastian Fischer. Last updated 1 months ago.
data-sciencedeep-learningmachine-learningmlr3torch
1.9 match 42 stars 7.63 score 78 scripts
pachadotdev
analogsea:Interface to 'DigitalOcean'
Provides a set of functions for interacting with the 'DigitalOcean' API <https://www.digitalocean.com/>, including creating images, destroying them, rebooting, getting details on regions, and available images.
Maintained by Mauricio Vargas. Last updated 2 years ago.
1.9 match 159 stars 7.56 score 100 scripts 1 dependents
foundryspatial
streamDepletr:Estimate Streamflow Depletion Due to Groundwater Pumping
Implementation of analytical models for estimating streamflow depletion due to groundwater pumping, and other related tools. Functions are broadly split into two groups: (1) analytical streamflow depletion models, which estimate streamflow depletion for a single stream reach resulting from groundwater pumping; and (2) depletion apportionment equations, which distribute estimated streamflow depletion among multiple stream reaches within a stream network. See Zipper et al. (2018) <doi:10.1029/2018WR022707> for more information on depletion apportionment equations and Zipper et al. (2019) <doi:10.1029/2018WR024403> for more information on analytical depletion functions, which combine analytical models and depletion apportionment equations.
Maintained by Sam Zipper. Last updated 1 years ago.
3.0 match 9 stars 4.65 score 7 scriptsmrc-ide
mcstate:Monte Carlo Methods for State Space Models
Implements Monte Carlo methods for state-space models such as 'SIR' models in epidemiology. Particle MCMC (pmcmc) and SMC2 methods are planned. This package is particularly designed to work with odin/dust models, but we will see how general it becomes.
Maintained by Rich FitzJohn. Last updated 9 months ago.
1.9 match 19 stars 7.08 score 87 scripts
marshalllab
MGDrivE:Mosquito Gene Drive Explorer
Provides a model designed to be a reliable testbed where various gene drive interventions for mosquito-borne diseases control. It is being developed to accommodate the use of various mosquito-specific gene drive systems within a population dynamics framework that allows migration of individuals between patches in landscape. Previous work developing the population dynamics can be found in Deredec et al. (2001) <doi:10.1073/pnas.1110717108> and Hancock & Godfray (2007) <doi:10.1186/1475-2875-6-98>, and extensions to accommodate CRISPR homing dynamics in Marshall et al. (2017) <doi:10.1038/s41598-017-02744-7>.
Maintained by Héctor Manuel Sánchez Castellanos. Last updated 4 years ago.
1.9 match 6 stars 7.06 score 61 scripts
eldarrak
FLightR:Reconstruct Animal Paths from Solar Geolocation Loggers Data
Spatio-temporal locations of an animal are computed from annotated data with a hidden Markov model via particle filter algorithm. The package is relatively robust to varying degrees of shading. The hidden Markov model is described in Movement Ecology - Rakhimberdiev et al. (2015) <doi:10.1186/s40462-015-0062-5>, general package description is in the Methods in Ecology and Evolution - Rakhimberdiev et al. (2017) <doi:10.1111/2041-210X.12765> and package accuracy assessed in the Journal of Avian Biology - Rakhimberdiev et al. (2016) <doi:10.1111/jav.00891>.
Maintained by Eldar Rakhimberdiev. Last updated 6 months ago.
movement-ecologysolar-geolocation-loggerssolar-geolocator
1.7 match 22 stars 7.26 score 111 scriptsropensci
MODIStsp:Find, Download and Process MODIS Land Products Data
Allows automating the creation of time series of rasters derived from MODIS satellite land products data. It performs several typical preprocessing steps such as download, mosaicking, reprojecting and resizing data acquired on a specified time period. All processing parameters can be set using a user-friendly GUI. Users can select which layers of the original MODIS HDF files they want to process, which additional quality indicators should be extracted from aggregated MODIS quality assurance layers and, in the case of surface reflectance products, which spectral indexes should be computed from the original reflectance bands. For each output layer, outputs are saved as single-band raster files corresponding to each available acquisition date. Virtual files allowing access to the entire time series as a single file are also created. Command-line execution exploiting a previously saved processing options file is also possible, allowing users to automatically update time series related to a MODIS product whenever a new image is available. For additional documentation refer to the following article: Busetto and Ranghetti (2016) <doi:10.1016/j.cageo.2016.08.020>.
Maintained by Luigi Ranghetti. Last updated 8 months ago.
gdalmodismodis-datamodis-land-productspeer-reviewedpreprocessingremote-sensingsatellite-imagerytime-series
1.5 match 156 stars 8.04 score 86 scripts 1 dependentsvusaverse
vvtableau:R Interface for 'Tableau' Services
Provides an R interface for interacting with the 'Tableau' Server. It allows users to perform various operations such as publishing workbooks, refreshing data extracts, and managing users using the 'Tableau' REST API (see <https://help.tableau.com/current/api/rest_api/en-us/REST/rest_api_ref.htm> for details). Additionally, it includes functions to perform manipulations on local 'Tableau' workbooks.
Maintained by Tomer Iwan. Last updated 7 months ago.
rest-apitableautableau-dashboardstableau-desktoptableau-rest-apitableau-server
1.9 match 7 stars 6.25 score 16 scriptspredictiveecology
LandR:Landscape Ecosystem Modelling in R
Utilities for 'LandR' suite of landscape simulation models. These models simulate forest vegetation dynamics based on LANDIS-II, and incorporate fire and insect disturbance, as well as other important ecological processes. Models are implemented as 'SpaDES' modules.
Maintained by Eliot J B McIntire. Last updated 4 days ago.
ecological-modellinglandscape-ecosystem-modellingspades
1.9 match 17 stars 6.07 score 12 scripts 4 dependents
lyzander
RDota2:An R Steam API Client for Valve's Dota2
An R API Client for Valve's Dota2. RDota2 can be easily used to connect to the Steam API and retrieve data for Valve's popular video game Dota2. You can find out more about Dota2 at <http://store.steampowered.com/app/570/>.
Maintained by Theo Boutaris. Last updated 8 years ago.
2.0 match 12 stars 5.24 score 29 scriptsbioc
biocthis:Automate package and project setup for Bioconductor packages
This package expands the usethis package with the goal of helping automate the process of creating R packages for Bioconductor or making them Bioconductor-friendly.
Maintained by Leonardo Collado-Torres. Last updated 3 months ago.
softwarereportwritingactionsbioconductorbiocthisgithubstylerusethis
1.3 match 51 stars 7.78 score 4 scripts 1 dependentsrstudio
connectwidgets:Organize and Curate Your Content Within 'Posit Connect'
A collection of helper functions and 'htmlwidgets' to help publishers curate content collections on 'Posit Connect'. The components, Card, Grid, Table, Search, and Filter can be used to produce a showcase page or gallery contained within a static or interactive R Markdown page.
Maintained by Brian Smith. Last updated 6 months ago.
1.5 match 22 stars 6.80 score 36 scripts
zabore
ppseq:Design Clinical Trials using Sequential Predictive Probability Monitoring
Functions are available to calibrate designs over a range of posterior and predictive thresholds, to plot the various design options, and to obtain the operating characteristics of optimal accuracy and optimal efficiency designs.
Maintained by Emily C. Zabor. Last updated 6 months ago.
1.6 match 5 stars 6.23 score 28 scripts
mhahsler
markovDP:Infrastructure for Discrete-Time Markov Decision Processes (MDP)
Provides the infrastructure to work with Markov Decision Processes (MDPs) in R. The focus is on convenience in formulating MDPs, the support of sparse representations (using sparse matrices, lists and data.frames) and visualization of results. Some key components are implemented in C++ to speed up computation. Several popular solvers are implemented.
Maintained by Michael Hahsler. Last updated 3 days ago.
control-theorymarkov-decision-processoptimizationcpp
1.8 match 7 stars 5.51 score 4 scripts
ocean-tracking-network
glatos:A package for the Great Lakes Acoustic Telemetry Observation System
Functions useful to members of the Great Lakes Acoustic Telemetry Observation System https://glatos.glos.us; many more broadly relevant to simulating, processing, analysing, and visualizing acoustic telemetry data.
Maintained by Christopher Holbrook. Last updated 6 months ago.
1.5 match 10 stars 6.38 score 112 scripts
pharmaverse
sdtmchecks:Data Quality Checks for Study Data Tabulation Model (SDTM) Datasets
A series of checks to identify common issues in Study Data Tabulation Model (SDTM) datasets. These checks are intended to be generalizable, actionable, and meaningful for analysis.
Maintained by Will Harris. Last updated 3 months ago.
1.3 match 21 stars 7.66 score 15 scriptscran
ragtop:Pricing Equity Derivatives with Extensions of Black-Scholes
Algorithms to price American and European equity options, convertible bonds and a variety of other financial derivatives. It uses an extension of the usual Black-Scholes model in which jump to default may occur at a probability specified by a power-law link between stock price and hazard rate as found in the paper by Takahashi, Kobayashi, and Nakagawa (2001) <doi:10.3905/jfi.2001.319302>. We use ideas and techniques from Andersen and Buffum (2002) <doi:10.2139/ssrn.355308> and Linetsky (2006) <doi:10.1111/j.1467-9965.2006.00271.x>.
Maintained by Brian K. Boonstra. Last updated 5 years ago.
3.5 match 2.70 score
anthonyebert
queuecomputer:Computationally Efficient Queue Simulation
Implementation of a computationally efficient method for simulating queues with arbitrary arrival and service times. Please see Ebert, Wu, Mengersen & Ruggeri (2020, <doi:10.18637/jss.v095.i05>) for further details.
Maintained by Anthony Ebert. Last updated 6 months ago.
1.5 match 36 stars 6.30 score 55 scripts
sinafala
SVDMx:Child/Child-Adult Mortality-Indexed Model Mortality Age Schedules
Model age schedules of mortality, nqx, suitable for a life table. This package implements the SVD-Comp mortality model indexed by either child or child/adult mortality. Given input value(s) of either 5q0 or (5q0, 45q15), the qx() function generates single-year 1qx or 5-year 5qx conditional age-specific probabilities of dying. See Clark (2016) <doi:10.48550/arXiv.1612.01408> and Clark (2019) <doi:10.1007/s13524-019-00785-3>.
Maintained by Samuel Clark. Last updated 1 months ago.
4.9 match 1.70 scoremrc-ide
hipercow:High Performance Computing
Set up cluster environments and jobs. Moo.
Maintained by Rich FitzJohn. Last updated 11 days ago.
1.3 match 1 stars 6.53 score 45 scripts 1 dependents
michlau
logicDT:Identifying Interactions Between Binary Predictors
A statistical learning method that tries to find the best set of predictors and interactions between predictors for modeling binary or quantitative response data in a decision tree. Several search algorithms and ensembling techniques are implemented allowing for finetuning the method to the specific problem. Interactions with quantitative covariables can be properly taken into account by fitting local regression models. Moreover, a variable importance measure for assessing marginal and interaction effects is provided. Implements the procedures proposed by Lau et al. (2024, <doi:10.1007/s10994-023-06488-6>).
Maintained by Michael Lau. Last updated 6 months ago.
4.0 match 2 stars 2.00 score 2 scripts
c3s
businessPlanR:Simple Modelling Tools for Business Plans
A collection of S4 classes, methods and functions to create and visualize business plans. Different types of cash flows can be defined, which can then be used and tabulated to create profit and loss statements, cash flow plans, investment and depreciation schedules, loan amortization schedules, etc. The methods are designed to produce handsome tables in both PDF and HTML using 'RMarkdown' or 'Shiny'.
Maintained by Meik Michalke. Last updated 2 years ago.
2.1 match 3.70 score 2 scripts
jarretrt
tci:Target Controlled Infusion (TCI)
Implementation of target-controlled infusion algorithms for compartmental pharmacokinetic and pharmacokinetic-pharmacodynamic models. Jacobs (1990) <doi:10.1109/10.43622>; Marsh et al. (1991) <doi:10.1093/bja/67.1.41>; Shafer and Gregg (1993) <doi:10.1007/BF01070999>; Schnider et al. (1998) <doi:10.1097/00000542-199805000-00006>; Abuhelwa, Foster, and Upton (2015) <doi:10.1016/j.vascn.2015.03.004>; Eleveld et al. (2018) <doi:10.1016/j.bja.2018.01.018>.
Maintained by Ryan Jarrett. Last updated 2 years ago.
2.3 match 6 stars 3.48 score 8 scripts
certe-medical-epidemiology
certeprojects:A Certe R Package for Department Projects
A Certe R Package with functions to automate department projects using MS Teams, MS Planner, Shiny, R Markdown and Quarto. This package is part of the 'certedata' universe.
Maintained by Matthijs S. Berends. Last updated 10 days ago.
microsoft-azuremicrosoft-outlookmicrosoft-plannermicrosoft-teamsmicrosoft365microsoft365rquartoshinyteams
1.9 match 2 stars 4.16 score 1 scripts 3 dependents
theeliteanalyst
Riex:IEX Stocks and Market Data
Retrieves efficiently and reliably Investors Exchange ('IEX') stock and market data using 'IEX Cloud API'. The platform is offered by Investors Exchange Group (IEX Group). Main goal is to leverage 'R' capabilities including existing packages to effectively provide financial and statistical analysis as well as visualization in support of fact-based decisions. In addition, continuously improve and enhance 'Riex' by applying best practices and being in tune with users' feedback and requirements. Please, make sure to review and acknowledge Investors Exchange Group (IEX Group) terms and conditions before using 'Riex' (<https://iexcloud.io/terms/>).
Maintained by Myriam Ibrahim. Last updated 4 years ago.
financefinancial-analysisfinancial-dataiexiex-apiiexcloud
1.7 match 9 stars 4.69 score 11 scripts
philchalmers
SimDesign:Structure for Organizing Monte Carlo Simulation Designs
Provides tools to safely and efficiently organize and execute Monte Carlo simulation experiments in R. The package controls the structure and back-end of Monte Carlo simulation experiments by utilizing a generate-analyse-summarise workflow. The workflow safeguards against common simulation coding issues, such as automatically re-simulating non-convergent results, prevents inadvertently overwriting simulation files, catches error and warning messages during execution, implicitly supports parallel processing with high-quality random number generation, and provides tools for managing high-performance computing (HPC) array jobs submitted to schedulers such as SLURM. For a pedagogical introduction to the package see Sigal and Chalmers (2016) <doi:10.1080/10691898.2016.1246953>. For a more in-depth overview of the package and its design philosophy see Chalmers and Adkins (2020) <doi:10.20982/tqmp.16.4.p248>.
Maintained by Phil Chalmers. Last updated 19 hours ago.
monte-carlo-simulationsimulationsimulation-framework
0.5 match 62 stars 13.36 score 253 scripts 46 dependents
renozao
doRNG:Generic Reproducible Parallel Backend for 'foreach' Loops
Provides functions to perform reproducible parallel foreach loops, using independent random streams as generated by L'Ecuyer's combined multiple-recursive generator [L'Ecuyer (1999), <DOI:10.1287/opre.47.1.159>]. It enables to easily convert standard '%dopar%' loops into fully reproducible loops, independently of the number of workers, the task scheduling strategy, or the chosen parallel environment and associated foreach backend.
Maintained by Renaud Gaujoux. Last updated 2 years ago.
0.5 match 20 stars 12.63 score 4.3k scripts 183 dependents
shikokuchuo
mirai:Minimalist Async Evaluation Framework for R
Designed for simplicity, a 'mirai' evaluates an R expression asynchronously in a parallel process, locally or distributed over the network. The result is automatically available upon completion. Modern networking and concurrency, built on 'nanonext' and 'NNG' (Nanomsg Next Gen), ensures reliable and efficient scheduling over fast inter-process communications or TCP/IP secured by TLS. Distributed computing can launch remote resources via SSH or cluster managers. An inherently queued architecture handles many more tasks than available processes, and requires no storage on the file system. Innovative features include support for otherwise non-exportable reference objects, event-driven promises, and asynchronous parallel map.
Maintained by Charlie Gao. Last updated 2 days ago.
asyncasynchronous-tasksconcurrencydistributed-computinghigh-performance-computingparallel-computing
0.5 match 217 stars 11.94 score 130 scripts 7 dependents
rmhogervorst
nsapi:Connect to the NS (Dutch Railways) API
Access the NS api and download current departure times, disruptions and engineering work, the station list, and travel recommendations from station to station. All results will be returned as a 'data.frame'. NS (Nederlandse Spoorwegen; Dutch Railways) is the largest train travel provider in the Netherlands. for more information about the API itself see <https://www.ns.nl/en/travel-information/ns-api>. To use the API, and this package, you will need to obtain a username and password. More information about authentication and the use of the functions are described in the vignette.
Maintained by Roel M. Hogervorst. Last updated 2 years ago.
api-clientnederlandse-spoorwegen-api
2.0 match 2 stars 3.00 score 9 scripts
mllg
batchtools:Tools for Computation on Batch Systems
As a successor of the packages 'BatchJobs' and 'BatchExperiments', this package provides a parallel implementation of the Map function for high performance computing systems managed by schedulers 'IBM Spectrum LSF' (<https://www.ibm.com/products/hpc-workload-management>), 'OpenLava' (<https://www.openlava.org/>), 'Univa Grid Engine'/'Oracle Grid Engine' (<https://www.univa.com/>), 'Slurm' (<https://slurm.schedmd.com/>), 'TORQUE/PBS' (<https://adaptivecomputing.com/cherry-services/torque-resource-manager/>), or 'Docker Swarm' (<https://docs.docker.com/engine/swarm/>). A multicore and socket mode allow the parallelization on a local machines, and multiple machines can be hooked up via SSH to create a makeshift cluster. Moreover, the package provides an abstraction mechanism to define large-scale computer experiments in a well-organized and reproducible way.
Maintained by Michel Lang. Last updated 2 years ago.
batchexperimentsbatchjobsdocker-swarmhigh-performance-computinghpchpc-clusterslsfopenlavaparallel-computingreproducibilitysgeslurmtorque
0.5 match 175 stars 11.39 score 772 scripts 14 dependents
nlmixr2
rxode2:Facilities for Simulating from ODE-Based Models
Facilities for running simulations from ordinary differential equation ('ODE') models, such as pharmacometrics and other compartmental models. A compilation manager translates the ODE model into C, compiles it, and dynamically loads the object code into R for improved computational efficiency. An event table object facilitates the specification of complex dosing regimens (optional) and sampling schedules. NB: The use of this package requires both C and Fortran compilers, for details on their use with R please see Section 6.3, Appendix A, and Appendix D in the "R Administration and Installation" manual. Also the code is mostly released under GPL. The 'VODE' and 'LSODA' are in the public domain. The information is available in the inst/COPYRIGHTS.
Maintained by Matthew L. Fidler. Last updated 30 days ago.
0.5 match 40 stars 11.24 score 220 scripts 13 dependents
wlandau
crew:A Distributed Worker Launcher Framework
In computationally demanding analysis projects, statisticians and data scientists asynchronously deploy long-running tasks to distributed systems, ranging from traditional clusters to cloud services. The 'NNG'-powered 'mirai' R package by Gao (2023) <doi:10.5281/zenodo.7912722> is a sleek and sophisticated scheduler that efficiently processes these intense workloads. The 'crew' package extends 'mirai' with a unifying interface for third-party worker launchers. Inspiration also comes from packages. 'future' by Bengtsson (2021) <doi:10.32614/RJ-2021-048>, 'rrq' by FitzJohn and Ashton (2023) <https://github.com/mrc-ide/rrq>, 'clustermq' by Schubert (2019) <doi:10.1093/bioinformatics/btz284>), and 'batchtools' by Lang, Bischel, and Surmann (2017) <doi:10.21105/joss.00135>.
Maintained by William Michael Landau. Last updated 2 days ago.
0.5 match 136 stars 11.19 score 243 scripts 2 dependents
philjoubert
SmithWilsonYieldCurve:Smith-Wilson Yield Curve Construction
Constructs a yield curve by the Smith-Wilson method from a table of libor and swap rates. Now updated to take bond coupons and prices in the same table.
Maintained by Phil Joubert. Last updated 8 months ago.
5.5 match 1 stars 1.00 score 4 scripts
mhpob
matos:Interface with the Mid-Atlantic Acoustic Telemetry Observing System (MATOS)
This package provides HTML-scaping functions to interact with the MATOS website (https://matos.asascience.com/), allowing aggregation of data and the downloading and posting of files.
Maintained by Michael OBrien. Last updated 3 months ago.
animal-trackingapiapi-wrapperbiotelemetryfishfisheriesfisheries-research
1.3 match 3 stars 4.35 score 9 scriptsddalthorp
eoa3:Wildlife Mortality Estimator for Low Fatality Rates and Imperfect Detection
Evidence of Absence software (EoA) is a user-friendly application for estimating bird and bat fatalities at wind farms and designing search protocols. The software is particularly useful in addressing whether the number of fatalities has exceeded a given threshold and what search parameters are needed to give assurance that thresholds were not exceeded. The models are applicable even when zero carcasses have been found in searches, following Huso et al. (2015) <doi:10.1890/14-0764.1>, Dalthorp et al. (2017) <doi:10.3133/ds1055>, and Dalthorp and Huso (2015) <doi:10.3133/ofr20151227>.
Maintained by Daniel Dalthorp. Last updated 4 months ago.
5.4 match 1.00 score
martinzaefferer
CEGO:Combinatorial Efficient Global Optimization
Model building, surrogate model based optimization and Efficient Global Optimization in combinatorial or mixed search spaces.
Maintained by Martin Zaefferer. Last updated 2 months ago.
1.7 match 1 stars 3.04 score 73 scripts
juan-goncalves-dosantos
ProjectManagement:Management of Deterministic and Stochastic Projects
Management problems of deterministic and stochastic projects. It obtains the duration of a project and the appropriate slack for each activity in a deterministic context. In addition it obtains a schedule of activities' time (Castro, Gómez & Tejada (2007) <doi:10.1016/j.orl.2007.01.003>). It also allows the management of resources. When the project is done, and the actual duration for each activity is known, then it can know how long the project is delayed and make a fair delivery of the delay between each activity (Bergantiños, Valencia-Toledo & Vidal-Puga (2018) <doi:10.1016/j.dam.2017.08.012>). In a stochastic context it can estimate the average duration of the project and plot the density of this duration, as well as, the density of the early and last times of the chosen activities. As in the deterministic case, it can make a distribution of the delay generated by observing the project already carried out.
Maintained by Juan Carlos Gonçalves Dosantos. Last updated 5 months ago.
4.8 match 1.00 score 9 scriptscran
FAwR:Functions and Datasets for "Forest Analytics with R"
Provides functions and datasets from the book "Forest Analytics with R".
Maintained by Andrew Robinson. Last updated 4 years ago.
3.6 match 2 stars 1.30 score
dyfanjones
sagemaker.mlcore:sagemaker machine learning core classes and methods
`sagemaker` machine learning core classes and methods.
Maintained by Dyfan Jones. Last updated 3 years ago.
amazon-sagemakerawsmachine-learningsagemakersdk
1.7 match 2.65 score 3 dependents
selesnow
rytstat:Work with 'YouTube API'
Provide function for get data from 'YouTube Data API' <https://developers.google.com/youtube/v3/docs/>, 'YouTube Analytics API' <https://developers.google.com/youtube/analytics/reference/> and 'YouTube Reporting API' <https://developers.google.com/youtube/reporting/v1/reports>.
Maintained by Alexey Seleznev. Last updated 10 months ago.
1.6 match 1 stars 2.78 score 12 scripts
uscbiostats
slurmR:A Lightweight Wrapper for 'Slurm'
'Slurm', Simple Linux Utility for Resource Management <https://slurm.schedmd.com/>, is a popular 'Linux' based software used to schedule jobs in 'HPC' (High Performance Computing) clusters. This R package provides a specialized lightweight wrapper of 'Slurm' with a syntax similar to that found in the 'parallel' R package. The package also includes a method for creating socket cluster objects spanning multiple nodes that can be used with the 'parallel' package.
Maintained by George Vega Yon. Last updated 1 years ago.
0.5 match 59 stars 8.06 score 216 scripts 1 dependents
cristiancastiglione
sgdGMF:Estimation of Generalized Matrix Factorization Models via Stochastic Gradient Descent
Efficient framework to estimate high-dimensional generalized matrix factorization models using penalized maximum likelihood under a dispersion exponential family specification. Either deterministic and stochastic methods are implemented for the numerical maximization. In particular, the package implements the stochastic gradient descent algorithm with a block-wise mini-batch strategy to speed up the computations and an efficient adaptive learning rate schedule to stabilize the convergence. All the theoretical details can be found in Castiglione, Segers, Clement, Risso (2024, <https://arxiv.org/abs/2412.20509>). Other methods considered for the optimization are the alternated iterative re-weighted least squares and the quasi-Newton method with diagonal approximation of the Fisher information matrix discussed in Kidzinski, Hui, Warton, Hastie (2022, <http://jmlr.org/papers/v23/20-1104.html>).
Maintained by Cristian Castiglione. Last updated 11 days ago.
0.5 match 10 stars 7.75 score 108 scripts
ek-lee
nlmeVPC:Visual Model Checking for Nonlinear Mixed Effect Model
Various visual and numerical diagnosis methods for the nonlinear mixed effect model, including visual predictive checks, numerical predictive checks, and coverage plots (Karlsson and Holford, 2008, <https://www.page-meeting.org/?abstract=1434>).
Maintained by Eun-Kyung Lee. Last updated 2 years ago.
3.6 match 1.04 score 11 scripts
lmiratrix
elec:Collection of Functions for Statistical Election Audits
This is a bizarre collection of functions written to do various sorts of statistical election audits. There are also functions to generate simulated voting data, and simulated "truth" so as to do simulations to check characteristics of these methods.
Maintained by Luke Mirarix. Last updated 3 years ago.
1.6 match 2.30 score 20 scriptsbbecker-bayer
interimApp:App for Scheduling Interim Analyses in Clinical Trials
Allows an interactive assessment of the timing of interim analyses. The algorithm simulates both the recruitment and treatment/event phase of a clinical trial based on the package 'interim'.
Maintained by Bastian Becker. Last updated 6 years ago.
2.9 match 1.00 scoremlr-org
mlr3batchmark:Batch Experiments for 'mlr3'
Extends the 'mlr3' package with a connector to the package 'batchtools'. This allows to run large-scale benchmark experiments on scheduled high-performance computing clusters.
Maintained by Marc Becker. Last updated 1 years ago.
batchtoolscluster-computinghigh-performance-computinghpcmlr3
0.5 match 5 stars 4.85 score 57 scripts
kzst
mfpp:'Matrix-Based Flexible Project Planning'
Matrix-Based Flexible Project Planning. This package models, plans, and schedules flexible, such as agile, extreme, and hybrid project plans. The package contains project planning, scheduling, and risk assessment functions. Kosztyan (2022) <doi:10.1016/j.softx.2022.100973>.
Maintained by Zsolt T. Kosztyan. Last updated 3 months ago.
0.8 match 3.00 score 1 scripts
joaquinauza
DetLifeInsurance:Life Insurance Premium and Reserves Valuation
Methods for valuation of life insurance premiums and reserves (including variable-benefit and fractional coverage) based on "Actuarial Mathematics" by Bowers, H.U. Gerber, J.C. Hickman, D.A. Jones and C.J. Nesbitt (1997, ISBN: 978-0938959465), "Actuarial Mathematics for Life Contingent Risks" by Dickson, David C. M., Hardy, Mary R. and Waters, Howard R (2009) <doi:10.1017/CBO9780511800146> and "Life Contingencies" by Jordan, C. W (1952) <doi:10.1017/S002026810005410X>. It also contains functions for equivalent interest and discount rate calculation, present and future values of annuities, and loan amortization schedule.
Maintained by Joaquin Auza. Last updated 5 years ago.
actuarialactuarial-sciencelife-insurance
0.5 match 10 stars 4.70 score 3 scripts
yh202109
mtb:My Toolbox for Assisting Document Editing and Data Presenting
The purpose of this package is to share a collection of functions the author wrote during weekends for managing kitchen and garden tasks, e.g. making plant growth charts or Thanksgiving kitchen schedule charts, etc. Functions might include but not limited to: (1) aiding summarizing time related data; (2) generating axis transformation from data; and (3) aiding Markdown (with html output) and Shiny file editing.
Maintained by Y Hsu. Last updated 15 days ago.
0.5 match 4.54 score 14 scripts
kumaragri
RepaymentPlan:Calculation of Mortgage Plan or Repayment Plan
The function RepaymentPlan() calculates repayment schedule for repayment/mortgage plans.
Maintained by Gourav Kumar Vani. Last updated 5 years ago.
2.3 match 1.00 score
opatp
GTFSwizard:Exploring and Manipulating 'GTFS' Files
Exploring, analyzing, and manipulating General Transit Feed Specification (GTFS) files, which represent public transportation schedules and geographic data. The package allows users to filter data by routes, trips, stops, and time, generate spatial visualizations, and perform detailed analyses of transit networks, including headway, dwell times, and route frequencies. Designed for transit planners, researchers, and data analysts, 'GTFSwizard' integrates functionalities from popular packages to enable efficient GTFS data manipulation and visualization.
Maintained by Nelson de O. Quesado Filho. Last updated 2 months ago.
0.5 match 1 stars 4.41 score
petermeissner
ical:'iCalendar' Parsing
A simple wrapper around the 'ical.js' library executing 'Javascript' code via 'V8' (the 'Javascript' engine driving the 'Chrome' browser and 'Node.js' and accessible via the 'V8' R package). This package enables users to parse 'iCalendar' files ('.ics', '.ifb', '.iCal', '.iFBf') into lists and 'data.frames' to ultimately do statistics on events, meetings, schedules, birthdays, and the like.
Maintained by Peter Meissner. Last updated 5 years ago.
0.5 match 18 stars 4.32 score 23 scripts
colindouglas
retrosheet:Import Professional Baseball Data from 'Retrosheet'
A collection of tools to import and structure the (currently) single-season event, game-log, roster, and schedule data available from <https://www.retrosheet.org>. In particular, the event (a.k.a. play-by-play) files can be especially difficult to parse. This package does the parsing on those files, returning the requested data in the most practical R structure to use for sabermetric or other analyses.
Maintained by Colin Douglas. Last updated 1 years ago.
baseball-analyticsbaseball-databaseball-statisticsgamelogretrosheet
0.5 match 5 stars 4.18 score 30 scripts
villegar
trainR:An Interface to the National Rail Enquiries Systems
The goal of 'trainR' is to provide a simple interface to the National Rail Enquiries (NRE) systems. There are few data feeds available, the simplest of them is Darwin, which provides real-time arrival and departure predictions, platform numbers, delay estimates, schedule changes and cancellations. Other data feeds provide historical data, Historic Service Performance (HSP), and much more. 'trainR' simplifies the data retrieval, so that the users can focus on their analyses. For more details visit <https://www.nationalrail.co.uk/46391.aspx>.
Maintained by Roberto Villegas-Diaz. Last updated 4 years ago.
national-railnational-rail-darwinnational-rail-enquiriesnreuk-railwayuk-trains
0.5 match 8 stars 3.60 score 8 scriptsropensci
jenkins:Simple Jenkins Client for R
Manage jobs and builds on your Jenkins CI server <https://jenkins.io/>. Create and edit projects, schedule builds, manage the queue, download build logs, and much more.
Maintained by Jeroen Ooms. Last updated 6 months ago.
0.5 match 21 stars 3.25 score 17 scripts
semipublicdlf
shinycroneditor:'shiny' Cron Expression Input Widget
A widget for 'shiny' apps to handle schedule expression input, using the 'cron-expression-input' JavaScript component. Note that this does not edit the 'crontab' file, it is just an input element for the schedules. See <https://github.com/DatalabFabriek/shinycroneditor/blob/main/inst/examples/shiny-app.R> for an example implementation.
Maintained by Harmen van der Veer. Last updated 6 months ago.
0.8 match 1.70 score 3 scripts
jie-qiao
HCR:Causal Discovery from Discrete Data using Hidden Compact Representation
This code provides a method to fit the hidden compact representation model as well as to identify the causal direction on discrete data. We implement an effective solution to recover the above hidden compact representation under the likelihood framework. Please see the Causal Discovery from Discrete Data using Hidden Compact Representation from NIPS 2018 by Ruichu Cai, Jie Qiao, Kun Zhang, Zhenjie Zhang and Zhifeng Hao (2018) <https://nips.cc/Conferences/2018/Schedule?showEvent=11274> for a description of some of our methods.
Maintained by Jie Qiao. Last updated 6 years ago.
0.5 match 1 stars 2.40 score 3 scripts
spectral-cockpit
specprepper:Plan and Apply Chained Preprocessing Operations on Spectra
Schedule and perform common spectroscopic signal processing (preprocessing) methods using a recipe-style syntax. Combine different operations in sequence.
Maintained by Philipp Baumann. Last updated 1 years ago.
0.5 match 1 stars 1.70 score
mj2149
Minirand:Minimization Randomization
Randomization schedules are generated in the schemes with k (k>=2) treatment groups and any allocation ratios by minimization algorithms.
Maintained by Man Jin. Last updated 5 years ago.
0.5 match 3 stars 1.48 score 5 scripts
akarl46556
mvglmmRank:Multivariate Generalized Linear Mixed Models for Ranking Sports Teams
Maximum likelihood estimates are obtained via an EM algorithm with either a first-order or a fully exponential Laplace approximation as documented by Broatch and Karl (2018) <doi:10.48550/arXiv.1710.05284>, Karl, Yang, and Lohr (2014) <doi:10.1016/j.csda.2013.11.019>, and by Karl (2012) <doi:10.1515/1559-0410.1471>. Karl and Zimmerman <doi:10.1016/j.jspi.2020.06.004> use this package to illustrate how the home field effect estimator from a mixed model can be biased under nonrandom scheduling.
Maintained by Andrew T. Karl. Last updated 2 years ago.
0.5 match 2 stars 1.34 score 11 scripts
vlospa99
corpmetrics:Tools for Valuation, Financial Metrics and Modeling in Corporate Finance
Balance sheet and income statement metrics, investment analysis methods, valuation methods, loan amortization schedules, and Capital Asset Pricing Model.
Maintained by Pavlos Pantatosakis. Last updated 6 months ago.
0.5 match 1.00 score