Showing 200 of total 13148 results (show query)
tidyverse
ggplot2:Create Elegant Data Visualisations Using the Grammar of Graphics
A system for 'declaratively' creating graphics, based on "The Grammar of Graphics". You provide the data, tell 'ggplot2' how to map variables to aesthetics, what graphical primitives to use, and it takes care of the details.
Maintained by Thomas Lin Pedersen. Last updated 6 days ago.
data-visualisationvisualisation
6.6k stars 25.10 score 645k scripts 7.6k dependentstidyverse
dplyr:A Grammar of Data Manipulation
A fast, consistent tool for working with data frame like objects, both in memory and out of memory.
Maintained by Hadley Wickham. Last updated 28 days ago.
4.8k stars 24.68 score 659k scripts 7.8k dependentstidyverse
tibble:Simple Data Frames
Provides a 'tbl_df' class (the 'tibble') with stricter checking and better formatting than the traditional data frame.
Maintained by Kirill Müller. Last updated 9 hours ago.
696 stars 22.88 score 47k scripts 11k dependentstidyverse
tidyr:Tidy Messy Data
Tools to help to create tidy data, where each column is a variable, each row is an observation, and each cell contains a single value. 'tidyr' contains tools for changing the shape (pivoting) and hierarchy (nesting and 'unnesting') of a dataset, turning deeply nested lists into rectangular data frames ('rectangling'), and extracting values out of string columns. It also includes tools for working with missing values (both implicit and explicit).
Maintained by Hadley Wickham. Last updated 28 days ago.
1.4k stars 22.88 score 168k scripts 5.5k dependentstidyverse
purrr:Functional Programming Tools
A complete and consistent functional programming toolkit for R.
Maintained by Hadley Wickham. Last updated 2 months ago.
1.3k stars 22.12 score 59k scripts 6.9k dependentstidyverse
stringr:Simple, Consistent Wrappers for Common String Operations
A consistent, simple and easy to use set of wrappers around the fantastic 'stringi' package. All function and argument names (and positions) are consistent, all functions deal with "NA"'s and zero length vectors in the same way, and the output from one function is easy to feed into the input of another.
Maintained by Hadley Wickham. Last updated 7 months ago.
628 stars 21.99 score 164k scripts 8.3k dependentstidymodels
broom:Convert Statistical Objects into Tidy Tibbles
Summarizes key information about statistical objects in tidy tibbles. This makes it easy to report results, create plots and consistently work with large numbers of models at once. Broom provides three verbs that each provide different types of information about a model. tidy() summarizes information about model components such as coefficients of a regression. glance() reports information about an entire model, such as goodness of fit measures like AIC and BIC. augment() adds information about individual observations to a dataset, such as fitted values or influence measures.
Maintained by Simon Couch. Last updated 3 days ago.
1.5k stars 21.58 score 37k scripts 1.5k dependentsigraph
igraph:Network Analysis and Visualization
Routines for simple graphs and network analysis. It can handle large graphs very well and provides functions for generating random and regular graphs, graph visualization, centrality methods and much more.
Maintained by Kirill Müller. Last updated 8 hours ago.
complex-networksgraph-algorithmsgraph-theorymathematicsnetwork-analysisnetwork-graphfortranlibxml2glpkopenblascpp
584 stars 21.14 score 31k scripts 1.9k dependentstidyverse
readxl:Read Excel Files
Import excel files into R. Supports '.xls' via the embedded 'libxls' C library <https://github.com/libxls/libxls> and '.xlsx' via the embedded 'RapidXML' C++ library <https://rapidxml.sourceforge.net/>. Works on Windows, Mac and Linux without external dependencies.
Maintained by Jennifer Bryan. Last updated 24 days ago.
734 stars 20.85 score 160k scripts 815 dependentstidyverse
tidyverse:Easily Install and Load the 'Tidyverse'
The 'tidyverse' is a set of packages that work in harmony because they share common data representations and 'API' design. This package is designed to make it easy to install and load multiple 'tidyverse' packages in a single step. Learn more about the 'tidyverse' at <https://www.tidyverse.org>.
Maintained by Hadley Wickham. Last updated 5 months ago.
1.7k stars 20.23 score 664k scripts 125 dependentstidyverse
readr:Read Rectangular Text Data
The goal of 'readr' is to provide a fast and friendly way to read rectangular data (like 'csv', 'tsv', and 'fwf'). It is designed to flexibly parse many types of data found in the wild, while still cleanly failing when data unexpectedly changes.
Maintained by Jennifer Bryan. Last updated 8 months ago.
1.0k stars 20.06 score 132k scripts 2.1k dependentsthomasp85
patchwork:The Composer of Plots
The 'ggplot2' package provides a strong API for sequentially building up a plot, but does not concern itself with composition of multiple plots. 'patchwork' is a package that expands the API to allow for arbitrarily complex composition of plots by, among others, providing mathematical operators for combining multiple plots. Other packages that try to address this need (but with a different approach) are 'gridExtra' and 'cowplot'.
Maintained by Thomas Lin Pedersen. Last updated 6 days ago.
ggplot-extensionggplot2visualization
2.5k stars 19.83 score 82k scripts 657 dependentstidyverse
dbplyr:A 'dplyr' Back End for Databases
A 'dplyr' back end for databases that allows you to work with remote database tables as if they are in-memory data frames. Basic features works with any database that has a 'DBI' back end; more advanced features require 'SQL' translation to be provided by the package author.
Maintained by Hadley Wickham. Last updated 4 months ago.
481 stars 19.72 score 5.2k scripts 736 dependentsr-lib
devtools:Tools to Make Developing R Packages Easier
Collection of package development tools.
Maintained by Jennifer Bryan. Last updated 6 months ago.
2.4k stars 19.55 score 51k scripts 150 dependentsplotly
plotly:Create Interactive Web Graphics via 'plotly.js'
Create interactive web graphics from 'ggplot2' graphs and/or a custom interface to the (MIT-licensed) JavaScript library 'plotly.js' inspired by the grammar of graphics.
Maintained by Carson Sievert. Last updated 4 months ago.
d3jsdata-visualizationggplot2javascriptplotlyshinywebgl
2.6k stars 19.43 score 93k scripts 797 dependentssfirke
janitor:Simple Tools for Examining and Cleaning Dirty Data
The main janitor functions can: perfectly format data.frame column names; provide quick counts of variable combinations (i.e., frequency tables and crosstabs); and explore duplicate records. Other janitor functions nicely format the tabulation results. These tabulate-and-report functions approximate popular features of SPSS and Microsoft Excel. This package follows the principles of the "tidyverse" and works well with the pipe function %>%. janitor was built with beginning-to-intermediate R users in mind and is optimized for user-friendliness.
Maintained by Sam Firke. Last updated 3 months ago.
data-analysisdata-cleaningdata-sciencedirty-dataexcelpivot-tablesspsstabulationstidyverse
1.4k stars 19.40 score 35k scripts 231 dependentshaozhu233
kableExtra:Construct Complex Table with 'kable' and Pipe Syntax
Build complex HTML or 'LaTeX' tables using 'kable()' from 'knitr' and the piping syntax from 'magrittr'. Function 'kable()' is a light weight table generator coming from 'knitr'. This package simplifies the way to manipulate the HTML or 'LaTeX' codes generated by 'kable()' and allows users to construct complex tables and customize styles using a readable syntax.
Maintained by Hao Zhu. Last updated 25 days ago.
htmlkablekableextraknitrlatexrmarkdown
702 stars 19.35 score 55k scripts 163 dependentstidyverse
rvest:Easily Harvest (Scrape) Web Pages
Wrappers around the 'xml2' and 'httr' packages to make it easy to download, then manipulate, HTML and XML.
Maintained by Hadley Wickham. Last updated 5 months ago.
1.5k stars 19.33 score 29k scripts 549 dependentsapache
arrow:Integration to 'Apache' 'Arrow'
'Apache' 'Arrow' <https://arrow.apache.org/> is a cross-language development platform for in-memory data. It specifies a standardized language-independent columnar memory format for flat and hierarchical data, organized for efficient analytic operations on modern hardware. This package provides an interface to the 'Arrow C++' library.
Maintained by Jonathan Keane. Last updated 2 months ago.
15k stars 19.25 score 10k scripts 82 dependentstopepo
caret:Classification and Regression Training
Misc functions for training and plotting classification and regression models.
Maintained by Max Kuhn. Last updated 4 months ago.
1.6k stars 19.24 score 61k scripts 303 dependentsslowkow
ggrepel:Automatically Position Non-Overlapping Text Labels with 'ggplot2'
Provides text and label geoms for 'ggplot2' that help to avoid overlapping text labels. Labels repel away from each other and away from the data points.
Maintained by Kamil Slowikowski. Last updated 5 months ago.
1.2k stars 19.20 score 37k scripts 1.2k dependentsstan-dev
rstan:R Interface to Stan
User-facing R functions are provided to parse, compile, test, estimate, and analyze Stan models by accessing the header-only Stan library provided by the 'StanHeaders' package. The Stan project develops a probabilistic programming language that implements full Bayesian statistical inference via Markov Chain Monte Carlo, rough Bayesian inference via 'variational' approximation, and (optionally penalized) maximum likelihood estimation via optimization. In all three cases, automatic differentiation is used to quickly and accurately evaluate gradients without burdening the user with the need to derive the partial derivatives.
Maintained by Ben Goodrich. Last updated 3 days ago.
bayesian-data-analysisbayesian-inferencebayesian-statisticsmcmcstancpp
1.1k stars 18.86 score 14k scripts 281 dependentswilkelab
cowplot:Streamlined Plot Theme and Plot Annotations for 'ggplot2'
Provides various features that help with creating publication-quality figures with 'ggplot2', such as a set of themes, functions to align plots and arrange them into complex compound figures, and functions that make it easy to annotate plots and or mix plots with images. The package was originally written for internal use in the Wilke lab, hence the name (Claus O. Wilke's plot package). It has also been used extensively in the book Fundamentals of Data Visualization.
Maintained by Claus O. Wilke. Last updated 3 months ago.
714 stars 18.83 score 75k scripts 1.4k dependentstidymodels
recipes:Preprocessing and Feature Engineering Steps for Modeling
A recipe prepares your data for modeling. We provide an extensible framework for pipeable sequences of feature engineering steps provides preprocessing tools to be applied to data. Statistical parameters for the steps can be estimated from an initial data set and then applied to other data sets. The resulting processed output can then be used as inputs for statistical or machine learning models.
Maintained by Max Kuhn. Last updated 3 days ago.
586 stars 18.80 score 7.2k scripts 383 dependentstidyverse
forcats:Tools for Working with Categorical Variables (Factors)
Helpers for reordering factor levels (including moving specified levels to front, ordering by first appearance, reversing, and randomly shuffling), and tools for modifying factor levels (including collapsing rare levels into other, 'anonymising', and manually 'recoding').
Maintained by Hadley Wickham. Last updated 1 years ago.
553 stars 18.79 score 21k scripts 1.2k dependentsr-dbi
RSQLite:SQLite Interface for R
Embeds the SQLite database engine in R and provides an interface compliant with the DBI package. The source for the SQLite engine and for various extensions in a recent version is included. System libraries will never be consulted because this package relies on static linking for the plugins it includes; this also ensures a consistent experience across all installations.
Maintained by Kirill Müller. Last updated 1 days ago.
331 stars 18.78 score 8.1k scripts 1.1k dependentstidyverse
haven:Import and Export 'SPSS', 'Stata' and 'SAS' Files
Import foreign statistical formats into R via the embedded 'ReadStat' C library, <https://github.com/WizardMac/ReadStat>.
Maintained by Hadley Wickham. Last updated 6 months ago.
427 stars 18.63 score 18k scripts 682 dependentsr-lib
roxygen2:In-Line Documentation for R
Generate your Rd documentation, 'NAMESPACE' file, and collation field using specially formatted comments. Writing documentation in-line with code makes it easier to keep your documentation up-to-date as your requirements change. 'roxygen2' is inspired by the 'Doxygen' system for C++.
Maintained by Hadley Wickham. Last updated 8 months ago.
606 stars 18.51 score 2.3k scripts 219 dependentsr-lib
pkgdown:Make Static HTML Documentation for a Package
Generate an attractive and useful website from a source package. 'pkgdown' converts your documentation, vignettes, 'README', and more to 'HTML' making it easy to share information about your package online.
Maintained by Hadley Wickham. Last updated 12 days ago.
734 stars 18.46 score 588 scripts 162 dependentsrstudio
gt:Easily Create Presentation-Ready Display Tables
Build display tables from tabular data with an easy-to-use set of functions. With its progressive approach, we can construct display tables with a cohesive set of table parts. Table values can be formatted using any of the included formatting functions. Footnotes and cell styles can be precisely added through a location targeting system. The way in which 'gt' handles things for you means that you don't often have to worry about the fine details.
Maintained by Richard Iannone. Last updated 26 days ago.
docxeasy-to-usehtmllatexrtfsummary-tables
2.1k stars 18.36 score 20k scripts 112 dependentsr-lib
pillar:Coloured Formatting for Columns
Provides 'pillar' and 'colonnade' generics designed for formatting columns of data using the full range of colours provided by modern terminals.
Maintained by Kirill Müller. Last updated 4 days ago.
178 stars 18.33 score 233 scripts 11k dependentsr-lib
tidyselect:Select from a Set of Strings
A backend for the selecting functions of the 'tidyverse'. It makes it easy to implement select-like functions in your own packages in a way that is consistent with other 'tidyverse' interfaces for selection.
Maintained by Lionel Henry. Last updated 4 months ago.
130 stars 18.31 score 1.9k scripts 8.2k dependentsnanxstats
ggsci:Scientific Journal and Sci-Fi Themed Color Palettes for 'ggplot2'
A collection of 'ggplot2' color palettes inspired by plots in scientific journals, data visualization libraries, science fiction movies, and TV shows.
Maintained by Nan Xiao. Last updated 10 months ago.
color-palettesdata-visualizationggplot2ggscisci-fiscientific-journalsvisualization
680 stars 18.00 score 26k scripts 438 dependentssjmgarnier
viridis:Colorblind-Friendly Color Maps for R
Color maps designed to improve graph readability for readers with common forms of color blindness and/or color vision deficiency. The color maps are also perceptually-uniform, both in regular form and also when converted to black-and-white for printing. This package also contains 'ggplot2' bindings for discrete and continuous color and fill scales. A lean version of the package called 'viridisLite' that does not include the 'ggplot2' bindings can be found at <https://cran.r-project.org/package=viridisLite>.
Maintained by Simon Garnier. Last updated 1 years ago.
298 stars 17.96 score 49k scripts 1.2k dependentstidyverse
vroom:Read and Write Rectangular Text Data Quickly
The goal of 'vroom' is to read and write data (like 'csv', 'tsv' and 'fwf') quickly. When reading it uses a quick initial indexing step, then reads the values lazily , so only the data you actually use needs to be read. The writer formats the data in parallel and writes to disk asynchronously from formatting.
Maintained by Jennifer Bryan. Last updated 7 months ago.
csvcsv-parserfixed-width-texttsvtsv-parsercpp
625 stars 17.82 score 4.5k scripts 2.1k dependentsr-lib
httr2:Perform HTTP Requests and Process the Responses
Tools for creating and modifying HTTP requests, then performing them and processing the results. 'httr2' is a modern re-imagining of 'httr' that uses a pipe-based interface and solves more of the problems that API wrapping packages face.
Maintained by Hadley Wickham. Last updated 4 days ago.
246 stars 17.64 score 1.9k scripts 1.1k dependentsharrelfe
Hmisc:Harrell Miscellaneous
Contains many functions useful for data analysis, high-level graphics, utility operations, functions for computing sample size and power, simulation, importing and annotating datasets, imputing missing values, advanced table making, variable clustering, character string manipulation, conversion of R objects to LaTeX and html code, recoding variables, caching, simplified parallel computing, encrypting and decrypting data using a safe workflow, general moving window statistical estimation, and assistance in interpreting principal component analysis.
Maintained by Frank E Harrell Jr. Last updated 6 days ago.
209 stars 17.64 score 17k scripts 750 dependentsr-lib
usethis:Automate Package and Project Setup
Automate package and project setup tasks that are otherwise performed manually. This includes setting up unit testing, test coverage, continuous integration, Git, 'GitHub', licenses, 'Rcpp', 'RStudio' projects, and more.
Maintained by Jennifer Bryan. Last updated 26 days ago.
869 stars 17.54 score 5.6k scripts 336 dependentsrobjhyndman
forecast:Forecasting Functions for Time Series and Linear Models
Methods and tools for displaying and analysing univariate time series forecasts including exponential smoothing via state space models and automatic ARIMA modelling.
Maintained by Rob Hyndman. Last updated 7 months ago.
forecastforecastingopenblascpp
1.1k stars 17.46 score 16k scripts 240 dependentsstan-dev
loo:Efficient Leave-One-Out Cross-Validation and WAIC for Bayesian Models
Efficient approximate leave-one-out cross-validation (LOO) for Bayesian models fit using Markov chain Monte Carlo, as described in Vehtari, Gelman, and Gabry (2017) <doi:10.1007/s11222-016-9696-4>. The approximation uses Pareto smoothed importance sampling (PSIS), a new procedure for regularizing importance weights. As a byproduct of the calculations, we also obtain approximate standard errors for estimated predictive errors and for the comparison of predictive errors between models. The package also provides methods for using stacking and other model weighting techniques to average Bayesian predictive distributions.
Maintained by Jonah Gabry. Last updated 18 days ago.
bayesbayesianbayesian-data-analysisbayesian-inferencebayesian-methodsbayesian-statisticscross-validationinformation-criterionmodel-comparisonstan
152 stars 17.30 score 2.6k scripts 297 dependentshadley
reshape2:Flexibly Reshape Data: A Reboot of the Reshape Package
Flexibly restructure and aggregate data using just two functions: melt and 'dcast' (or 'acast').
Maintained by Hadley Wickham. Last updated 4 years ago.
210 stars 17.19 score 94k scripts 2.0k dependentstalgalili
dendextend:Extending 'dendrogram' Functionality in R
Offers a set of functions for extending 'dendrogram' objects in R, letting you visualize and compare trees of 'hierarchical clusterings'. You can (1) Adjust a tree's graphical parameters - the color, size, type, etc of its branches, nodes and labels. (2) Visually and statistically compare different 'dendrograms' to one another.
Maintained by Tal Galili. Last updated 2 months ago.
154 stars 17.13 score 6.0k scripts 165 dependentsgesistsa
rio:A Swiss-Army Knife for Data I/O
Streamlined data import and export by making assumptions that the user is probably willing to make: 'import()' and 'export()' determine the data format from the file extension, reasonable defaults are used for data import and export, web-based import is natively supported (including from SSL/HTTPS), compressed files can be read directly, and fast import packages are used where appropriate. An additional convenience function, 'convert()', provides a simple method for converting between file types.
Maintained by Chung-hong Chan. Last updated 3 months ago.
csvcsvydatadata-scienceexcelioriosasspssstata
610 stars 17.10 score 7.8k scripts 74 dependentsbioc
clusterProfiler:A universal enrichment tool for interpreting omics data
This package supports functional characteristics of both coding and non-coding genomics data for thousands of species with up-to-date gene annotation. It provides a univeral interface for gene functional annotation from a variety of sources and thus can be applied in diverse scenarios. It provides a tidy interface to access, manipulate, and visualize enrichment results to help users achieve efficient data interpretation. Datasets obtained from multiple treatments and time points can be analyzed and compared in a single run, easily revealing functional consensus and differences among distinct conditions.
Maintained by Guangchuang Yu. Last updated 4 months ago.
annotationclusteringgenesetenrichmentgokeggmultiplecomparisonpathwaysreactomevisualizationenrichment-analysisgsea
1.1k stars 17.03 score 11k scripts 48 dependentsddsjoberg
gtsummary:Presentation-Ready Data Summary and Analytic Result Tables
Creates presentation-ready tables summarizing data sets, regression models, and more. The code to create the tables is concise and highly customizable. Data frames can be summarized with any function, e.g. mean(), median(), even user-written functions. Regression models are summarized and include the reference rows for categorical variables. Common regression models, such as logistic regression and Cox proportional hazards regression, are automatically identified and the tables are pre-filled with appropriate column headers.
Maintained by Daniel D. Sjoberg. Last updated 6 days ago.
easy-to-usegthtml5regression-modelsreproducibilityreproducible-researchstatisticssummary-statisticssummary-tablestable1tableone
1.1k stars 17.02 score 8.2k scripts 15 dependentsthomasp85
ggraph:An Implementation of Grammar of Graphics for Graphs and Networks
The grammar of graphics as implemented in ggplot2 is a poor fit for graph and network visualizations due to its reliance on tabular data input. ggraph is an extension of the ggplot2 API tailored to graph visualizations and provides the same flexible approach to building up plots layer by layer.
Maintained by Thomas Lin Pedersen. Last updated 1 years ago.
ggplot-extensionggplot2graph-visualizationnetwork-visualizationvisualizationcpp
1.1k stars 16.96 score 9.2k scripts 111 dependentsconst-ae
ggsignif:Significance Brackets for 'ggplot2'
Enrich your 'ggplots' with group-wise comparisons. This package provides an easy way to indicate if two groups are significantly different. Commonly this is shown by a bracket on top connecting the groups of interest which itself is annotated with the level of significance (NS, *, **, ***). The package provides a single layer (geom_signif()) that takes the groups for comparison and the test (t.test(), wilcox.text() etc.) as arguments and adds the annotation to the plot.
Maintained by Constantin Ahlmann-Eltze. Last updated 8 months ago.
asteriskggplot-extensionggplot2significance-stars
601 stars 16.89 score 3.6k scripts 417 dependentssatijalab
Seurat:Tools for Single Cell Genomics
A toolkit for quality control, analysis, and exploration of single cell RNA sequencing data. 'Seurat' aims to enable users to identify and interpret sources of heterogeneity from single cell transcriptomic measurements, and to integrate diverse types of single cell data. See Satija R, Farrell J, Gennert D, et al (2015) <doi:10.1038/nbt.3192>, Macosko E, Basu A, Satija R, et al (2015) <doi:10.1016/j.cell.2015.05.002>, Stuart T, Butler A, et al (2019) <doi:10.1016/j.cell.2019.05.031>, and Hao, Hao, et al (2020) <doi:10.1101/2020.10.12.335331> for more details.
Maintained by Paul Hoffman. Last updated 1 years ago.
human-cell-atlassingle-cell-genomicssingle-cell-rna-seqcpp
2.4k stars 16.86 score 50k scripts 73 dependentsjuliasilge
tidytext:Text Mining using 'dplyr', 'ggplot2', and Other Tidy Tools
Using tidy data principles can make many text mining tasks easier, more effective, and consistent with tools already in wide use. Much of the infrastructure needed for text mining with tidy data frames already exists in packages like 'dplyr', 'broom', 'tidyr', and 'ggplot2'. In this package, we provide functions and supporting data sets to allow conversion of text to and from tidy formats, and to switch seamlessly between tidy tools and existing text mining packages.
Maintained by Julia Silge. Last updated 12 months ago.
natural-language-processingtext-miningtidy-datatidyverse
1.2k stars 16.86 score 17k scripts 61 dependentsbioc
ggtree:an R package for visualization of tree and annotation data
'ggtree' extends the 'ggplot2' plotting system which implemented the grammar of graphics. 'ggtree' is designed for visualization and annotation of phylogenetic trees and other tree-like structures with their annotation data.
Maintained by Guangchuang Yu. Last updated 5 months ago.
alignmentannotationclusteringdataimportmultiplesequencealignmentphylogeneticsreproducibleresearchsoftwarevisualizationannotationsggplot2phylogenetic-trees
871 stars 16.83 score 5.1k scripts 109 dependentsropensci
skimr:Compact and Flexible Summaries of Data
A simple to use summary function that can be used with pipes and displays nicely in the console. The default summary statistics may be modified by the user as can the default formatting. Support for data frames and vectors is included, and users can implement their own skim methods for specific object types as described in a vignette. Default summaries include support for inline spark graphs. Instructions for managing these on specific operating systems are given in the "Using skimr" vignette and the README.
Maintained by Elin Waring. Last updated 2 months ago.
peer-reviewedropenscisummary-statisticsunconfunconf17
1.1k stars 16.80 score 18k scripts 14 dependentstidymodels
rsample:General Resampling Infrastructure
Classes and functions to create and summarize different types of resampling objects (e.g. bootstrap, cross-validation).
Maintained by Hannah Frick. Last updated 20 days ago.
341 stars 16.72 score 5.2k scripts 79 dependentswilkelab
ggridges:Ridgeline Plots in 'ggplot2'
Ridgeline plots provide a convenient way of visualizing changes in distributions over time or space. This package enables the creation of such plots in 'ggplot2'.
Maintained by Claus O. Wilke. Last updated 4 months ago.
418 stars 16.71 score 14k scripts 285 dependentsklausvigo
phangorn:Phylogenetic Reconstruction and Analysis
Allows for estimation of phylogenetic trees and networks using Maximum Likelihood, Maximum Parsimony, distance methods and Hadamard conjugation (Schliep 2011). Offers methods for tree comparison, model selection and visualization of phylogenetic networks as described in Schliep et al. (2017).
Maintained by Klaus Schliep. Last updated 3 days ago.
softwaretechnologyqualitycontrolphylogenetic-analysisphylogeneticsopenblascpp
206 stars 16.70 score 2.5k scripts 135 dependentsstan-dev
bayesplot:Plotting for Bayesian Models
Plotting functions for posterior analysis, MCMC diagnostics, prior and posterior predictive checks, and other visualizations to support the applied Bayesian workflow advocated in Gabry, Simpson, Vehtari, Betancourt, and Gelman (2019) <doi:10.1111/rssa.12378>. The package is designed not only to provide convenient functionality for users, but also a common set of functions that can be easily used by developers working on a variety of R packages for Bayesian modeling, particularly (but not exclusively) packages interfacing with 'Stan'.
Maintained by Jonah Gabry. Last updated 2 months ago.
bayesianggplot2mcmcpandocstanstatistical-graphicsvisualization
436 stars 16.69 score 6.5k scripts 98 dependentskassambara
ggpubr:'ggplot2' Based Publication Ready Plots
The 'ggplot2' package is excellent and flexible for elegant data visualization in R. However the default generated plots requires some formatting before we can send them for publication. Furthermore, to customize a 'ggplot', the syntax is opaque and this raises the level of difficulty for researchers with no advanced R programming skills. 'ggpubr' provides some easy-to-use functions for creating and customizing 'ggplot2'- based publication ready plots.
Maintained by Alboukadel Kassambara. Last updated 2 years ago.
1.2k stars 16.68 score 65k scripts 409 dependentspaul-buerkner
brms:Bayesian Regression Models using 'Stan'
Fit Bayesian generalized (non-)linear multivariate multilevel models using 'Stan' for full Bayesian inference. A wide range of distributions and link functions are supported, allowing users to fit -- among others -- linear, robust linear, count data, survival, response times, ordinal, zero-inflated, hurdle, and even self-defined mixture models all in a multilevel context. Further modeling options include both theory-driven and data-driven non-linear terms, auto-correlation structures, censoring and truncation, meta-analytic standard errors, and quite a few more. In addition, all parameters of the response distribution can be predicted in order to perform distributional regression. Prior specifications are flexible and explicitly encourage users to apply prior distributions that actually reflect their prior knowledge. Models can easily be evaluated and compared using several methods assessing posterior or prior predictions. References: Bürkner (2017) <doi:10.18637/jss.v080.i01>; Bürkner (2018) <doi:10.32614/RJ-2018-017>; Bürkner (2021) <doi:10.18637/jss.v100.i05>; Carpenter et al. (2017) <doi:10.18637/jss.v076.i01>.
Maintained by Paul-Christian Bürkner. Last updated 5 days ago.
bayesian-inferencebrmsmultilevel-modelsstanstatistical-models
1.3k stars 16.64 score 13k scripts 35 dependentsamices
mice:Multivariate Imputation by Chained Equations
Multiple imputation using Fully Conditional Specification (FCS) implemented by the MICE algorithm as described in Van Buuren and Groothuis-Oudshoorn (2011) <doi:10.18637/jss.v045.i03>. Each variable has its own imputation model. Built-in imputation models are provided for continuous data (predictive mean matching, normal), binary data (logistic regression), unordered categorical data (polytomous logistic regression) and ordered categorical data (proportional odds). MICE can also impute continuous two-level data (normal model, pan, second-level variables). Passive imputation can be used to maintain consistency between variables. Various diagnostic plots are available to inspect the quality of the imputations.
Maintained by Stef van Buuren. Last updated 3 days ago.
chained-equationsfcsimputationmicemissing-datamissing-valuesmultiple-imputationmultivariate-datacpp
462 stars 16.64 score 10k scripts 154 dependentstidyverse
hms:Pretty Time of Day
Implements an S3 class for storing and formatting time-of-day values, based on the 'difftime' class.
Maintained by Kirill Müller. Last updated 5 days ago.
141 stars 16.54 score 1.3k scripts 3.2k dependentstidymodels
tidymodels:Easily Install and Load the 'Tidymodels' Packages
The tidy modeling "verse" is a collection of packages for modeling and statistical analysis that share the underlying design philosophy, grammar, and data structures of the tidyverse.
Maintained by Max Kuhn. Last updated 1 months ago.
783 stars 16.52 score 66k scripts 15 dependentstidyverse
modelr:Modelling Functions that Work with the Pipe
Functions for modelling that help you seamlessly integrate modelling into a pipeline of data manipulation and visualisation.
Maintained by Hadley Wickham. Last updated 1 years ago.
400 stars 16.46 score 6.9k scripts 1.1k dependentstidymodels
parsnip:A Common API to Modeling and Analysis Functions
A common interface is provided to allow users to specify a model without having to remember the different argument names across different functions or computational engines (e.g. 'R', 'Spark', 'Stan', 'H2O', etc).
Maintained by Max Kuhn. Last updated 19 days ago.
612 stars 16.37 score 3.4k scripts 69 dependentsbioc
fgsea:Fast Gene Set Enrichment Analysis
The package implements an algorithm for fast gene set enrichment analysis. Using the fast algorithm allows to make more permutations and get more fine grained p-values, which allows to use accurate stantard approaches to multiple hypothesis correction.
Maintained by Alexey Sergushichev. Last updated 12 days ago.
geneexpressiondifferentialexpressiongenesetenrichmentpathwayscpp
392 stars 16.31 score 3.9k scripts 101 dependentsr-dbi
odbc:Connect to ODBC Compatible Databases (using the DBI Interface)
A DBI-compatible interface to ODBC databases.
Maintained by Hadley Wickham. Last updated 4 days ago.
396 stars 16.31 score 2.9k scripts 23 dependentsr-tmap
tmap:Thematic Maps
Thematic maps are geographical maps in which spatial data distributions are visualized. This package offers a flexible, layer-based, and easy to use approach to create thematic maps, such as choropleths and bubble maps.
Maintained by Martijn Tennekes. Last updated 3 days ago.
choropleth-mapsmapsspatialthematic-mapsvisualisation
879 stars 16.25 score 13k scripts 24 dependentsstan-dev
posterior:Tools for Working with Posterior Distributions
Provides useful tools for both users and developers of packages for fitting Bayesian models or working with output from Bayesian models. The primary goals of the package are to: (a) Efficiently convert between many different useful formats of draws (samples) from posterior or prior distributions. (b) Provide consistent methods for operations commonly performed on draws, for example, subsetting, binding, or mutating draws. (c) Provide various summaries of draws in convenient formats. (d) Provide lightweight implementations of state of the art posterior inference diagnostics. References: Vehtari et al. (2021) <doi:10.1214/20-BA1221>.
Maintained by Paul-Christian Bürkner. Last updated 3 days ago.
168 stars 16.21 score 3.3k scripts 346 dependentsjrnold
ggthemes:Extra Themes, Scales and Geoms for 'ggplot2'
Some extra themes, geoms, and scales for 'ggplot2'. Provides 'ggplot2' themes and scales that replicate the look of plots by Edward Tufte, Stephen Few, 'Fivethirtyeight', 'The Economist', 'Stata', 'Excel', and 'The Wall Street Journal', among others. Provides 'geoms' for Tufte's box plot and range frame.
Maintained by Jeffrey B. Arnold. Last updated 1 years ago.
data-visualisationggplot2ggplot2-themesplotplottingthemevisualization
1.3k stars 16.17 score 40k scripts 102 dependentsggobi
GGally:Extension to 'ggplot2'
The R package 'ggplot2' is a plotting system based on the grammar of graphics. 'GGally' extends 'ggplot2' by adding several functions to reduce the complexity of combining geometric objects with transformed data. Some of these functions include a pairwise plot matrix, a two group pairwise plot matrix, a parallel coordinates plot, a survival plot, and several functions to plot networks.
Maintained by Barret Schloerke. Last updated 11 months ago.
597 stars 16.15 score 17k scripts 154 dependentsr-lib
styler:Non-Invasive Pretty Printing of R Code
Pretty-prints R code without changing the user's formatting intent.
Maintained by Lorenz Walthert. Last updated 2 months ago.
754 stars 16.15 score 940 scripts 62 dependentsbioc
DESeq2:Differential gene expression analysis based on the negative binomial distribution
Estimate variance-mean dependence in count data from high-throughput sequencing assays and test for differential expression based on a model using the negative binomial distribution.
Maintained by Michael Love. Last updated 26 days ago.
sequencingrnaseqchipseqgeneexpressiontranscriptionnormalizationdifferentialexpressionbayesianregressionprincipalcomponentclusteringimmunooncologyopenblascpp
375 stars 16.11 score 17k scripts 115 dependentstidyverse
dtplyr:Data Table Back-End for 'dplyr'
Provides a data.table backend for 'dplyr'. The goal of 'dtplyr' is to allow you to write 'dplyr' code that is automatically translated to the equivalent, but usually much faster, data.table code.
Maintained by Hadley Wickham. Last updated 2 months ago.
671 stars 16.11 score 2.5k scripts 148 dependentsbioc
biomaRt:Interface to BioMart databases (i.e. Ensembl)
In recent years a wealth of biological data has become available in public data repositories. Easy access to these valuable data resources and firm integration with data analysis is needed for comprehensive bioinformatics data analysis. biomaRt provides an interface to a growing collection of databases implementing the BioMart software suite (<http://www.biomart.org>). The package enables retrieval of large amounts of data in a uniform way without the need to know the underlying database schemas or write complex SQL queries. The most prominent examples of BioMart databases are maintain by Ensembl, which provides biomaRt users direct access to a diverse set of data and enables a wide range of powerful online queries from gene annotation to database mining.
Maintained by Mike Smith. Last updated 17 days ago.
annotationbioconductorbiomartensembl
38 stars 15.99 score 13k scripts 230 dependentsthomasp85
ggforce:Accelerating 'ggplot2'
The aim of 'ggplot2' is to aid in visual data investigations. This focus has led to a lack of facilities for composing specialised plots. 'ggforce' aims to be a collection of mainly new stats and geoms that fills this gap. All additional functionality is aimed to come through the official extension system so using 'ggforce' should be a stable experience.
Maintained by Thomas Lin Pedersen. Last updated 6 days ago.
ggplot-extensionggplot2visualizationcpp
929 stars 15.98 score 9.3k scripts 298 dependentskassambara
survminer:Drawing Survival Curves using 'ggplot2'
Contains the function 'ggsurvplot()' for drawing easily beautiful and 'ready-to-publish' survival curves with the 'number at risk' table and 'censoring count plot'. Other functions are also available to plot adjusted curves for `Cox` model and to visually examine 'Cox' model assumptions.
Maintained by Alboukadel Kassambara. Last updated 5 months ago.
524 stars 15.87 score 7.0k scripts 55 dependentstidymodels
infer:Tidy Statistical Inference
The objective of this package is to perform inference using an expressive statistical grammar that coheres with the tidy design framework.
Maintained by Simon Couch. Last updated 6 months ago.
736 stars 15.75 score 3.5k scripts 18 dependentsr-lib
progress:Terminal Progress Bars
Configurable Progress bars, they may include percentage, elapsed time, and/or the estimated completion time. They work in terminals, in 'Emacs' 'ESS', 'RStudio', 'Windows' 'Rgui' and the 'macOS' 'R.app'. The package also provides a 'C++' 'API', that works with or without 'Rcpp'.
Maintained by Gábor Csárdi. Last updated 5 months ago.
470 stars 15.72 score 2.1k scripts 3.0k dependentswilkelab
ggtext:Improved Text Rendering Support for 'ggplot2'
A 'ggplot2' extension that enables the rendering of complex formatted plot labels (titles, subtitles, facet labels, axis labels, etc.). Text boxes with automatic word wrap are also supported.
Maintained by Brenton M. Wiernik. Last updated 3 years ago.
657 stars 15.71 score 13k scripts 155 dependentsbioc
enrichplot:Visualization of Functional Enrichment Result
The 'enrichplot' package implements several visualization methods for interpreting functional enrichment results obtained from ORA or GSEA analysis. It is mainly designed to work with the 'clusterProfiler' package suite. All the visualization methods are developed based on 'ggplot2' graphics.
Maintained by Guangchuang Yu. Last updated 3 months ago.
annotationgenesetenrichmentgokeggpathwayssoftwarevisualizationenrichment-analysispathway-analysis
239 stars 15.71 score 3.1k scripts 58 dependentsstan-dev
rstanarm:Bayesian Applied Regression Modeling via Stan
Estimates previously compiled regression models using the 'rstan' package, which provides the R interface to the Stan C++ library for Bayesian estimation. Users specify models via the customary R syntax with a formula and data.frame plus some additional arguments for priors.
Maintained by Ben Goodrich. Last updated 12 days ago.
bayesianbayesian-data-analysisbayesian-inferencebayesian-methodsbayesian-statisticsmultilevel-modelsrstanrstanarmstanstatistical-modelingcpp
393 stars 15.70 score 5.0k scripts 13 dependentsr-lib
profvis:Interactive Visualizations for Profiling R Code
Interactive visualizations for profiling R code.
Maintained by Hadley Wickham. Last updated 6 months ago.
310 stars 15.64 score 1.3k scripts 153 dependentsnjtierney
naniar:Data Structures, Summaries, and Visualisations for Missing Data
Missing values are ubiquitous in data and need to be explored and handled in the initial stages of analysis. 'naniar' provides data structures and functions that facilitate the plotting of missing values and examination of imputations. This allows missing data dependencies to be explored with minimal deviation from the common work patterns of 'ggplot2' and tidy data. The work is fully discussed at Tierney & Cook (2023) <doi:10.18637/jss.v105.i07>.
Maintained by Nicholas Tierney. Last updated 18 days ago.
data-visualisationggplot2missing-datamissingnesstidy-data
657 stars 15.63 score 5.1k scripts 9 dependentsprophet:Automatic Forecasting Procedure
Implements a procedure for forecasting time series data based on an additive model where non-linear trends are fit with yearly, weekly, and daily seasonality, plus holiday effects. It works best with time series that have strong seasonal effects and several seasons of historical data. Prophet is robust to missing data and shifts in the trend, and typically handles outliers well.
Maintained by Sean Taylor. Last updated 5 months ago.
19k stars 15.59 score 976 scripts 13 dependentsr-lib
gh:'GitHub' 'API'
Minimal client to access the 'GitHub' 'API'.
Maintained by Gábor Csárdi. Last updated 2 months ago.
224 stars 15.55 score 444 scripts 401 dependentsthomasp85
gganimate:A Grammar of Animated Graphics
The grammar of graphics as implemented in the 'ggplot2' package has been successful in providing a powerful API for creating static visualisation. In order to extend the API for animated graphics this package provides a completely new set of grammar, fully compatible with 'ggplot2' for specifying transitions and animations in a flexible and extensible way.
Maintained by Thomas Lin Pedersen. Last updated 6 days ago.
animationdata-visualizationggplot-extensionggplot2transition
2.0k stars 15.53 score 13k scripts 24 dependentsrstudio
tensorflow:R Interface to 'TensorFlow'
Interface to 'TensorFlow' <https://www.tensorflow.org/>, an open source software library for numerical computation using data flow graphs. Nodes in the graph represent mathematical operations, while the graph edges represent the multidimensional data arrays (tensors) communicated between them. The flexible architecture allows you to deploy computation to one or more 'CPUs' or 'GPUs' in a desktop, server, or mobile device with a single 'API'. 'TensorFlow' was originally developed by researchers and engineers working on the Google Brain Team within Google's Machine Intelligence research organization for the purposes of conducting machine learning and deep neural networks research, but the system is general enough to be applicable in a wide variety of other domains as well.
Maintained by Tomasz Kalinowski. Last updated 5 days ago.
1.3k stars 15.47 score 3.2k scripts 75 dependentstidymodels
yardstick:Tidy Characterizations of Model Performance
Tidy tools for quantifying how well model fits to a data set such as confusion matrices, class probability curve summaries, and regression metrics (e.g., RMSE).
Maintained by Emil Hvitfeldt. Last updated 19 days ago.
387 stars 15.47 score 2.2k scripts 60 dependentseclarke
ggbeeswarm:Categorical Scatter (Violin Point) Plots
Provides two methods of plotting categorical scatter plots such that the arrangement of points within a category reflects the density of data at that region, and avoids over-plotting.
Maintained by Erik Clarke. Last updated 5 months ago.
550 stars 15.45 score 7.6k scripts 84 dependentsr-forge
car:Companion to Applied Regression
Functions to Accompany J. Fox and S. Weisberg, An R Companion to Applied Regression, Third Edition, Sage, 2019.
Maintained by John Fox. Last updated 5 months ago.
15.38 score 43k scripts 919 dependentsstatnet
ergm:Fit, Simulate and Diagnose Exponential-Family Models for Networks
An integrated set of tools to analyze and simulate networks based on exponential-family random graph models (ERGMs). 'ergm' is a part of the Statnet suite of packages for network analysis. See Hunter, Handcock, Butts, Goodreau, and Morris (2008) <doi:10.18637/jss.v024.i03> and Krivitsky, Hunter, Morris, and Klumb (2023) <doi:10.18637/jss.v105.i06>.
Maintained by Pavel N. Krivitsky. Last updated 21 days ago.
100 stars 15.36 score 1.4k scripts 36 dependentsbioc
GenomicFeatures:Query the gene models of a given organism/assembly
Extract the genomic locations of genes, transcripts, exons, introns, and CDS, for the gene models stored in a TxDb object. A TxDb object is a small database that contains the gene models of a given organism/assembly. Bioconductor provides a small collection of TxDb objects in the form of ready-to-install TxDb packages for the most commonly studied organisms. Additionally, the user can easily make a TxDb object (or package) for the organism/assembly of their choice by using the tools from the txdbmaker package.
Maintained by H. Pagès. Last updated 5 months ago.
geneticsinfrastructureannotationsequencinggenomeannotationbioconductor-packagecore-package
26 stars 15.34 score 5.3k scripts 339 dependentshms-dbmi
UpSetR:A More Scalable Alternative to Venn and Euler Diagrams for Visualizing Intersecting Sets
Creates visualizations of intersecting sets using a novel matrix design, along with visualizations of several common set, element and attribute related tasks (Conway 2017) <doi:10.1093/bioinformatics/btx364>.
Maintained by Jake Conway. Last updated 4 years ago.
gehlenborglabggplot2upsetupsetrvisualization
781 stars 15.33 score 4.8k scripts 42 dependentsgforge
htmlTable:Advanced Tables for Markdown/HTML
Tables with state-of-the-art layout elements such as row spanners, column spanners, table spanners, zebra striping, and more. While allowing advanced layout, the underlying css-structure is simple in order to maximize compatibility with common word processors. The package also contains a few text formatting functions that help outputting text compatible with HTML/LaTeX.
Maintained by Max Gordon. Last updated 8 months ago.
79 stars 15.33 score 1.3k scripts 767 dependentsrich-iannone
DiagrammeR:Graph/Network Visualization
Build graph/network structures using functions for stepwise addition and deletion of nodes and edges. Work with data available in tables for bulk addition of nodes, edges, and associated metadata. Use graph selections and traversals to apply changes to specific nodes or edges. A wide selection of graph algorithms allow for the analysis of graphs. Visualize the graphs and take advantage of any aesthetic properties assigned to nodes and edges.
Maintained by Richard Iannone. Last updated 2 months ago.
graphgraph-functionsnetwork-graphproperty-graphvisualization
1.7k stars 15.29 score 3.8k scripts 86 dependentskassambara
rstatix:Pipe-Friendly Framework for Basic Statistical Tests
Provides a simple and intuitive pipe-friendly framework, coherent with the 'tidyverse' design philosophy, for performing basic statistical tests, including t-test, Wilcoxon test, ANOVA, Kruskal-Wallis and correlation analyses. The output of each test is automatically transformed into a tidy data frame to facilitate visualization. Additional functions are available for reshaping, reordering, manipulating and visualizing correlation matrix. Functions are also included to facilitate the analysis of factorial experiments, including purely 'within-Ss' designs (repeated measures), purely 'between-Ss' designs, and mixed 'within-and-between-Ss' designs. It's also possible to compute several effect size metrics, including "eta squared" for ANOVA, "Cohen's d" for t-test and 'Cramer V' for the association between categorical variables. The package contains helper functions for identifying univariate and multivariate outliers, assessing normality and homogeneity of variances.
Maintained by Alboukadel Kassambara. Last updated 2 years ago.
458 stars 15.27 score 11k scripts 432 dependentsbbolker
broom.mixed:Tidying Methods for Mixed Models
Convert fitted objects from various R mixed-model packages into tidy data frames along the lines of the 'broom' package. The package provides three S3 generics for each model: tidy(), which summarizes a model's statistical findings such as coefficients of a regression; augment(), which adds columns to the original data such as predictions, residuals and cluster assignments; and glance(), which provides a one-row summary of model-level statistics.
Maintained by Ben Bolker. Last updated 7 days ago.
230 stars 15.22 score 4.0k scripts 37 dependentssparklyr
sparklyr:R Interface to Apache Spark
R interface to Apache Spark, a fast and general engine for big data processing, see <https://spark.apache.org/>. This package supports connecting to local and remote Apache Spark clusters, provides a 'dplyr' compatible back-end, and provides an interface to Spark's built-in machine learning algorithms.
Maintained by Edgar Ruiz. Last updated 13 days ago.
apache-sparkdistributeddplyridelivymachine-learningremote-clusterssparksparklyr
959 stars 15.20 score 4.0k scripts 21 dependentsropensci
targets:Dynamic Function-Oriented 'Make'-Like Declarative Pipelines
Pipeline tools coordinate the pieces of computationally demanding analysis projects. The 'targets' package is a 'Make'-like pipeline tool for statistics and data science in R. The package skips costly runtime for tasks that are already up to date, orchestrates the necessary computation with implicit parallel computing, and abstracts files as R objects. If all the current output matches the current upstream code and data, then the whole pipeline is up to date, and the results are more trustworthy than otherwise. The methodology in this package borrows from GNU 'Make' (2015, ISBN:978-9881443519) and 'drake' (2018, <doi:10.21105/joss.00550>).
Maintained by William Michael Landau. Last updated 3 days ago.
data-sciencehigh-performance-computingmakepeer-reviewedpipeliner-targetopiareproducibilityreproducible-researchtargetsworkflow
978 stars 15.16 score 4.6k scripts 22 dependentsbioc
AnnotationDbi:Manipulation of SQLite-based annotations in Bioconductor
Implements a user-friendly interface for querying SQLite-based annotation data packages.
Maintained by Bioconductor Package Maintainer. Last updated 5 months ago.
annotationmicroarraysequencinggenomeannotationbioconductor-packagecore-package
9 stars 15.05 score 3.6k scripts 769 dependentslarmarange
labelled:Manipulating Labelled Data
Work with labelled data imported from 'SPSS' or 'Stata' with 'haven' or 'foreign'. This package provides useful functions to deal with "haven_labelled" and "haven_labelled_spss" classes introduced by 'haven' package.
Maintained by Joseph Larmarange. Last updated 1 months ago.
havenlabelsmetadatasasspssstata
76 stars 15.04 score 2.4k scripts 98 dependentshojsgaard
doBy:Groupwise Statistics, LSmeans, Linear Estimates, Utilities
Utility package containing: 1) Facilities for working with grouped data: 'do' something to data stratified 'by' some variables. 2) LSmeans (least-squares means), general linear estimates. 3) Restrict functions to a smaller domain. 4) Miscellaneous other utilities.
Maintained by Søren Højsgaard. Last updated 20 hours ago.
1 stars 14.99 score 3.2k scripts 948 dependentsbioc
DOSE:Disease Ontology Semantic and Enrichment analysis
This package implements five methods proposed by Resnik, Schlicker, Jiang, Lin and Wang respectively for measuring semantic similarities among DO terms and gene products. Enrichment analyses including hypergeometric model and gene set enrichment analysis are also implemented for discovering disease associations of high-throughput biological data.
Maintained by Guangchuang Yu. Last updated 5 months ago.
annotationvisualizationmultiplecomparisongenesetenrichmentpathwayssoftwaredisease-ontologyenrichment-analysissemantic-similarity
119 stars 14.97 score 2.0k scripts 61 dependentstidyverse
googledrive:An Interface to Google Drive
Manage Google Drive files from R.
Maintained by Jennifer Bryan. Last updated 8 months ago.
329 stars 14.97 score 2.1k scripts 164 dependentsmjskay
ggdist:Visualizations of Distributions and Uncertainty
Provides primitives for visualizing distributions using 'ggplot2' that are particularly tuned for visualizing uncertainty in either a frequentist or Bayesian mode. Both analytical distributions (such as frequentist confidence distributions or Bayesian priors) and distributions represented as samples (such as bootstrap distributions or Bayesian posterior samples) are easily visualized. Visualization primitives include but are not limited to: points with multiple uncertainty intervals, eye plots (Spiegelhalter D., 1999) <https://ideas.repec.org/a/bla/jorssa/v162y1999i1p45-58.html>, density plots, gradient plots, dot plots (Wilkinson L., 1999) <doi:10.1080/00031305.1999.10474474>, quantile dot plots (Kay M., Kola T., Hullman J., Munson S., 2016) <doi:10.1145/2858036.2858558>, complementary cumulative distribution function barplots (Fernandes M., Walls L., Munson S., Hullman J., Kay M., 2018) <doi:10.1145/3173574.3173718>, and fit curves with multiple uncertainty ribbons.
Maintained by Matthew Kay. Last updated 4 months ago.
ggplot2uncertaintyuncertainty-visualizationvisualizationcpp
859 stars 14.95 score 3.1k scripts 62 dependentsguido-s
meta:General Package for Meta-Analysis
User-friendly general package providing standard methods for meta-analysis and supporting Schwarzer, Carpenter, and Rücker <DOI:10.1007/978-3-319-21416-0>, "Meta-Analysis with R" (2015): - common effect and random effects meta-analysis; - several plots (forest, funnel, Galbraith / radial, L'Abbe, Baujat, bubble); - three-level meta-analysis model; - generalised linear mixed model; - logistic regression with penalised likelihood for rare events; - Hartung-Knapp method for random effects model; - Kenward-Roger method for random effects model; - prediction interval; - statistical tests for funnel plot asymmetry; - trim-and-fill method to evaluate bias in meta-analysis; - meta-regression; - cumulative meta-analysis and leave-one-out meta-analysis; - import data from 'RevMan 5'; - produce forest plot summarising several (subgroup) meta-analyses.
Maintained by Guido Schwarzer. Last updated 3 days ago.
89 stars 14.95 score 2.3k scripts 30 dependentsbioc
MultiAssayExperiment:Software for the integration of multi-omics experiments in Bioconductor
Harmonize data management of multiple experimental assays performed on an overlapping set of specimens. It provides a familiar Bioconductor user experience by extending concepts from SummarizedExperiment, supporting an open-ended mix of standard data classes for individual assays, and allowing subsetting by genomic ranges or rownames. Facilities are provided for reshaping data into wide and long formats for adaptability to graphing and downstream analysis.
Maintained by Marcel Ramos. Last updated 2 months ago.
infrastructuredatarepresentationbioconductorbioconductor-packagegenomicsnci-itcrtcgau24ca289073
71 stars 14.94 score 670 scripts 126 dependentsphilchalmers
mirt:Multidimensional Item Response Theory
Analysis of discrete response data using unidimensional and multidimensional item analysis models under the Item Response Theory paradigm (Chalmers (2012) <doi:10.18637/jss.v048.i06>). Exploratory and confirmatory item factor analysis models are estimated with quadrature (EM) or stochastic (MHRM) methods. Confirmatory bi-factor and two-tier models are available for modeling item testlets using dimension reduction EM algorithms, while multiple group analyses and mixed effects designs are included for detecting differential item, bundle, and test functioning, and for modeling item and person covariates. Finally, latent class models such as the DINA, DINO, multidimensional latent class, mixture IRT models, and zero-inflated response models are supported, as well as a wide family of probabilistic unfolding models.
Maintained by Phil Chalmers. Last updated 4 days ago.
212 stars 14.93 score 2.5k scripts 40 dependentstidymodels
hardhat:Construct Modeling Packages
Building modeling packages is hard. A large amount of effort generally goes into providing an implementation for a new method that is efficient, fast, and correct, but often less emphasis is put on the user interface. A good interface requires specialized knowledge about S3 methods and formulas, which the average package developer might not have. The goal of 'hardhat' is to reduce the burden around building new modeling packages by providing functionality for preprocessing, predicting, and validating input.
Maintained by Hannah Frick. Last updated 2 months ago.
103 stars 14.88 score 175 scripts 436 dependentscynkra
dm:Relational Data Models
Provides tools for working with multiple related tables, stored as data frames or in a relational database. Multiple tables (data and metadata) are stored in a compound object, which can then be manipulated with a pipe-friendly syntax.
Maintained by Kirill Müller. Last updated 3 months ago.
data-modeldata-warehousingdatawarehousingdbidbplyrrelational-databases
511 stars 14.81 score 410 scripts 8 dependentsr-dbi
RPostgres:C++ Interface to PostgreSQL
Fully DBI-compliant C++-backed interface to PostgreSQL <https://www.postgresql.org/>, an open-source relational database.
Maintained by Kirill Müller. Last updated 1 months ago.
338 stars 14.78 score 1.6k scripts 31 dependentsbioc
GSVA:Gene Set Variation Analysis for Microarray and RNA-Seq Data
Gene Set Variation Analysis (GSVA) is a non-parametric, unsupervised method for estimating variation of gene set enrichment through the samples of a expression data set. GSVA performs a change in coordinate systems, transforming the data from a gene by sample matrix to a gene-set by sample matrix, thereby allowing the evaluation of pathway enrichment for each sample. This new matrix of GSVA enrichment scores facilitates applying standard analytical methods like functional enrichment, survival analysis, clustering, CNV-pathway analysis or cross-tissue pathway analysis, in a pathway-centric manner.
Maintained by Robert Castelo. Last updated 10 days ago.
functionalgenomicsmicroarrayrnaseqpathwaysgenesetenrichmentgene-set-enrichmentgenomicspathway-enrichment-analysis
212 stars 14.74 score 1.6k scripts 19 dependentsflorianhartig
DHARMa:Residual Diagnostics for Hierarchical (Multi-Level / Mixed) Regression Models
The 'DHARMa' package uses a simulation-based approach to create readily interpretable scaled (quantile) residuals for fitted (generalized) linear mixed models. Currently supported are linear and generalized linear (mixed) models from 'lme4' (classes 'lmerMod', 'glmerMod'), 'glmmTMB', 'GLMMadaptive', and 'spaMM'; phylogenetic linear models from 'phylolm' (classes 'phylolm' and 'phyloglm'); generalized additive models ('gam' from 'mgcv'); 'glm' (including 'negbin' from 'MASS', but excluding quasi-distributions) and 'lm' model classes. Moreover, externally created simulations, e.g. posterior predictive simulations from Bayesian software such as 'JAGS', 'STAN', or 'BUGS' can be processed as well. The resulting residuals are standardized to values between 0 and 1 and can be interpreted as intuitively as residuals from a linear regression. The package also provides a number of plot and test functions for typical model misspecification problems, such as over/underdispersion, zero-inflation, and residual spatial, phylogenetic and temporal autocorrelation.
Maintained by Florian Hartig. Last updated 27 days ago.
glmmregressionregression-diagnosticsresidual
226 stars 14.74 score 2.8k scripts 10 dependentsthomasp85
tidygraph:A Tidy API for Graph Manipulation
A graph, while not "tidy" in itself, can be thought of as two tidy data frames describing node and edge data respectively. 'tidygraph' provides an approach to manipulate these two virtual data frames using the API defined in the 'dplyr' package, as well as provides tidy interfaces to a lot of common graph algorithms.
Maintained by Thomas Lin Pedersen. Last updated 2 months ago.
graph-algorithmsgraph-manipulationigraphnetwork-analysistidyversecpp
553 stars 14.74 score 4.6k scripts 136 dependentsmjskay
tidybayes:Tidy Data and 'Geoms' for Bayesian Models
Compose data for and extract, manipulate, and visualize posterior draws from Bayesian models ('JAGS', 'Stan', 'rstanarm', 'brms', 'MCMCglmm', 'coda', ...) in a tidy data format. Functions are provided to help extract tidy data frames of draws from Bayesian models and that generate point summaries and intervals in a tidy format. In addition, 'ggplot2' 'geoms' and 'stats' are provided for common visualization primitives like points with multiple uncertainty intervals, eye plots (intervals plus densities), and fit curves with multiple, arbitrary uncertainty bands.
Maintained by Matthew Kay. Last updated 7 months ago.
bayesian-data-analysisbrmsggplot2jagsstantidy-datavisualization
733 stars 14.72 score 7.3k scripts 20 dependentshusson
FactoMineR:Multivariate Exploratory Data Analysis and Data Mining
Exploratory data analysis methods to summarize, visualize and describe datasets. The main principal component methods are available, those with the largest potential in terms of applications: principal component analysis (PCA) when variables are quantitative, correspondence analysis (CA) and multiple correspondence analysis (MCA) when variables are categorical, Multiple Factor Analysis when variables are structured in groups, etc. and hierarchical cluster analysis. F. Husson, S. Le and J. Pages (2017).
Maintained by Francois Husson. Last updated 4 months ago.
47 stars 14.71 score 5.6k scripts 112 dependentsdcomtois
summarytools:Tools to Quickly and Neatly Summarize Data
Data frame summaries, cross-tabulations, weight-enabled frequency tables and common descriptive (univariate) statistics in concise tables available in a variety of formats (plain ASCII, Markdown and HTML). A good point-of-entry for exploring data, both for experienced and new R users.
Maintained by Dominic Comtois. Last updated 5 days ago.
descriptive-statisticsfrequency-tablehtml-reportmarkdownpanderpandocpandoc-markdownrmarkdownrstudio
527 stars 14.62 score 2.9k scripts 6 dependentssinhrks
ggfortify:Data Visualization Tools for Statistical Analysis Results
Unified plotting tools for statistics commonly used, such as GLM, time series, PCA families, clustering and survival analysis. The package offers a single plotting interface for these analysis results and plots in a unified style using 'ggplot2'.
Maintained by Yuan Tang. Last updated 9 months ago.
528 stars 14.60 score 9.1k scripts 24 dependentstidyverse
googlesheets4:Access Google Sheets using the Sheets API V4
Interact with Google Sheets through the Sheets API v4 <https://developers.google.com/sheets/api>. "API" is an acronym for "application programming interface"; the Sheets API allows users to interact with Google Sheets programmatically, instead of via a web browser. The "v4" refers to the fact that the Sheets API is currently at version 4. This package can read and write both the metadata and the cell data in a Sheet.
Maintained by Jennifer Bryan. Last updated 8 months ago.
google-drivegoogle-sheetsspreadsheet
363 stars 14.55 score 7.0k scripts 142 dependentsr-lib
clock:Date-Time Types and Tools
Provides a comprehensive library for date-time manipulations using a new family of orthogonal date-time classes (durations, time points, zoned-times, and calendars) that partition responsibilities so that the complexities of time zones are only considered when they are really needed. Capabilities include: date-time parsing, formatting, arithmetic, extraction and updating of components, and rounding.
Maintained by Davis Vaughan. Last updated 14 days ago.
106 stars 14.53 score 296 scripts 407 dependentshojsgaard
pbkrtest:Parametric Bootstrap, Kenward-Roger and Satterthwaite Based Methods for Test in Mixed Models
Computes p-values based on (a) Satterthwaite or Kenward-Rogers degree of freedom methods and (b) parametric bootstrap for mixed effects models as implemented in the 'lme4' package. Implements parametric bootstrap test for generalized linear mixed models as implemented in 'lme4' and generalized linear models. The package is documented in the paper by Halekoh and Højsgaard, (2012, <doi:10.18637/jss.v059.i09>). Please see 'citation("pbkrtest")' for citation details.
Maintained by Søren Højsgaard. Last updated 15 hours ago.
6 stars 14.53 score 648 scripts 929 dependentsropensci
osmdata:Import 'OpenStreetMap' Data as Simple Features or Spatial Objects
Download and import of 'OpenStreetMap' ('OSM') data as 'sf' or 'sp' objects. 'OSM' data are extracted from the 'Overpass' web server (<https://overpass-api.de/>) and processed with very fast 'C++' routines for return to 'R'.
Maintained by Mark Padgham. Last updated 2 months ago.
open0street0mapopenstreetmapoverpass0apiosmcpposm-dataoverpass-apipeer-reviewedcpp
322 stars 14.53 score 2.8k scripts 14 dependentsjacob-long
jtools:Analysis and Presentation of Social Scientific Data
This is a collection of tools for more efficiently understanding and sharing the results of (primarily) regression analyses. There are also a number of miscellaneous functions for statistical and programming purposes. Support for models produced by the survey and lme4 packages are points of emphasis.
Maintained by Jacob A. Long. Last updated 7 months ago.
167 stars 14.48 score 4.0k scripts 14 dependentstidyverts
tsibble:Tidy Temporal Data Frames and Tools
Provides a 'tbl_ts' class (the 'tsibble') for temporal data in an data- and model-oriented format. The 'tsibble' provides tools to easily manipulate and analyse temporal data, such as filling in time gaps and aggregating over calendar periods.
Maintained by Earo Wang. Last updated 2 months ago.
536 stars 14.48 score 4.4k scripts 42 dependentsbioc
TCGAbiolinks:TCGAbiolinks: An R/Bioconductor package for integrative analysis with GDC data
The aim of TCGAbiolinks is : i) facilitate the GDC open-access data retrieval, ii) prepare the data using the appropriate pre-processing strategies, iii) provide the means to carry out different standard analyses and iv) to easily reproduce earlier research results. In more detail, the package provides multiple methods for analysis (e.g., differential expression analysis, identifying differentially methylated regions) and methods for visualization (e.g., survival plots, volcano plots, starburst plots) in order to easily develop complete analysis pipelines.
Maintained by Tiago Chedraoui Silva. Last updated 1 months ago.
dnamethylationdifferentialmethylationgeneregulationgeneexpressionmethylationarraydifferentialexpressionpathwaysnetworksequencingsurvivalsoftwarebiocbioconductorgdcintegrative-analysistcgatcga-datatcgabiolinks
310 stars 14.47 score 1.6k scripts 6 dependentsindrajeetpatil
ggstatsplot:'ggplot2' Based Plots with Statistical Details
Extension of 'ggplot2', 'ggstatsplot' creates graphics with details from statistical tests included in the plots themselves. It provides an easier syntax to generate information-rich plots for statistical analysis of continuous (violin plots, scatterplots, histograms, dot plots, dot-and-whisker plots) or categorical (pie and bar charts) data. Currently, it supports the most common types of statistical approaches and tests: parametric, nonparametric, robust, and Bayesian versions of t-test/ANOVA, correlation analyses, contingency table analysis, meta-analysis, and regression analyses. References: Patil (2021) <doi:10.21105/joss.03236>.
Maintained by Indrajeet Patil. Last updated 1 months ago.
bayes-factorsdatasciencedatavizeffect-sizeggplot-extensionhypothesis-testingnon-parametric-statisticsregression-modelsstatistical-analysis
2.1k stars 14.46 score 3.0k scripts 1 dependentsstatistikat
VIM:Visualization and Imputation of Missing Values
New tools for the visualization of missing and/or imputed values are introduced, which can be used for exploring the data and the structure of the missing and/or imputed values. Depending on this structure of the missing values, the corresponding methods may help to identify the mechanism generating the missing values and allows to explore the data including missing values. In addition, the quality of imputation can be visually explored using various univariate, bivariate, multiple and multivariate plot methods. A graphical user interface available in the separate package VIMGUI allows an easy handling of the implemented plot methods.
Maintained by Matthias Templ. Last updated 8 months ago.
hotdeckimputation-methodsmodel-predictionsvisualizationcpp
85 stars 14.44 score 2.6k scripts 19 dependentssingmann
afex:Analysis of Factorial Experiments
Convenience functions for analyzing factorial experiments using ANOVA or mixed models. aov_ez(), aov_car(), and aov_4() allow specification of between, within (i.e., repeated-measures), or mixed (i.e., split-plot) ANOVAs for data in long format (i.e., one observation per row), automatically aggregating multiple observations per individual and cell of the design. mixed() fits mixed models using lme4::lmer() and computes p-values for all fixed effects using either Kenward-Roger or Satterthwaite approximation for degrees of freedom (LMM only), parametric bootstrap (LMMs and GLMMs), or likelihood ratio tests (LMMs and GLMMs). afex_plot() provides a high-level interface for interaction or one-way plots using ggplot2, combining raw data and model estimates. afex uses type 3 sums of squares as default (imitating commercial statistical software).
Maintained by Henrik Singmann. Last updated 7 months ago.
124 stars 14.43 score 1.4k scripts 15 dependentsdavidgohel
ggiraph:Make 'ggplot2' Graphics Interactive
Create interactive 'ggplot2' graphics using 'htmlwidgets'.
Maintained by David Gohel. Last updated 3 days ago.
822 stars 14.37 score 4.1k scripts 35 dependentstidymodels
dials:Tools for Creating Tuning Parameter Values
Many models contain tuning parameters (i.e. parameters that cannot be directly estimated from the data). These tools can be used to define objects for creating, simulating, or validating values for such parameters.
Maintained by Hannah Frick. Last updated 2 months ago.
114 stars 14.31 score 426 scripts 52 dependentsbioc
xcms:LC-MS and GC-MS Data Analysis
Framework for processing and visualization of chromatographically separated and single-spectra mass spectral data. Imports from AIA/ANDI NetCDF, mzXML, mzData and mzML files. Preprocesses data for high-throughput, untargeted analyte profiling.
Maintained by Steffen Neumann. Last updated 17 days ago.
immunooncologymassspectrometrymetabolomicsbioconductorfeature-detectionmass-spectrometrypeak-detectioncpp
196 stars 14.31 score 984 scripts 11 dependentstidymodels
tune:Tidy Tuning Tools
The ability to tune models is important. 'tune' contains functions and classes to be used in conjunction with other 'tidymodels' packages for finding reasonable values of hyper-parameters in models, pre-processing methods, and post-processing steps.
Maintained by Max Kuhn. Last updated 27 days ago.
293 stars 14.27 score 756 scripts 39 dependentstalgalili
heatmaply:Interactive Cluster Heat Maps Using 'plotly' and 'ggplot2'
Create interactive cluster 'heatmaps' that can be saved as a stand- alone HTML file, embedded in 'R Markdown' documents or in a 'Shiny' app, and available in the 'RStudio' viewer pane. Hover the mouse pointer over a cell to show details or drag a rectangle to zoom. A 'heatmap' is a popular graphical method for visualizing high-dimensional data, in which a table of numbers are encoded as a grid of colored cells. The rows and columns of the matrix are ordered to highlight patterns and are often accompanied by 'dendrograms'. 'Heatmaps' are used in many fields for visualizing observations, correlations, missing values patterns, and more. Interactive 'heatmaps' allow the inspection of specific value by hovering the mouse over a cell, as well as zooming into a region of the 'heatmap' by dragging a rectangle around the relevant area. This work is based on the 'ggplot2' and 'plotly.js' engine. It produces similar 'heatmaps' to 'heatmap.2' with the advantage of speed ('plotly.js' is able to handle larger size matrix), the ability to zoom from the 'dendrogram' panes, and the placing of factor variables in the sides of the 'heatmap'.
Maintained by Tal Galili. Last updated 9 months ago.
d3-heatmapdendextenddendrogramggplot2heatmapplotly
386 stars 14.21 score 2.0k scripts 45 dependentsbusiness-science
timetk:A Tool Kit for Working with Time Series
Easy visualization, wrangling, and feature engineering of time series data for forecasting and machine learning prediction. Consolidates and extends time series functionality from packages including 'dplyr', 'stats', 'xts', 'forecast', 'slider', 'padr', 'recipes', and 'rsample'.
Maintained by Matt Dancho. Last updated 1 years ago.
coercioncoercion-functionsdata-miningdplyrforecastforecastingforecasting-modelsmachine-learningseries-decompositionseries-signaturetibbletidytidyquanttidyversetimetime-seriestimeseries
626 stars 14.20 score 4.0k scripts 16 dependentseliocamp
ggnewscale:Multiple Fill and Colour Scales in 'ggplot2'
Use multiple fill and colour scales in 'ggplot2'.
Maintained by Elio Campitelli. Last updated 1 months ago.
414 stars 14.18 score 4.9k scripts 136 dependentsrstudio
pins:Pin, Discover, and Share Resources
Publish data sets, models, and other R objects, making it easy to share them across projects and with your colleagues. You can pin objects to a variety of "boards", including local folders (to share on a networked drive or with 'DropBox'), 'Posit Connect', 'AWS S3', and more.
Maintained by Julia Silge. Last updated 2 months ago.
azuregcloudrpinsrsconnects3storage
321 stars 14.17 score 1.9k scripts 17 dependentsdkahle
ggmap:Spatial Visualization with ggplot2
A collection of functions to visualize spatial data and models on top of static maps from various online sources (e.g Google Maps and Stamen Maps). It includes tools common to those tasks, including functions for geolocation and routing.
Maintained by David Kahle. Last updated 1 years ago.
770 stars 14.17 score 12k scripts 31 dependentsdoi-usgs
dataRetrieval:Retrieval Functions for USGS and EPA Hydrology and Water Quality Data
Collection of functions to help retrieve U.S. Geological Survey and U.S. Environmental Protection Agency water quality and hydrology data from web services. Data are discovered from National Water Information System <https://waterservices.usgs.gov/> and <https://waterdata.usgs.gov/nwis>. Water quality data are obtained from the Water Quality Portal <https://www.waterqualitydata.us/>.
Maintained by Laura DeCicco. Last updated 5 days ago.
286 stars 14.16 score 1.7k scripts 15 dependentscorybrunson
ggalluvial:Alluvial Plots in 'ggplot2'
Alluvial plots use variable-width ribbons and stacked bar plots to represent multi-dimensional or repeated-measures data with categorical or ordinal variables; see Riehmann, Hanfler, and Froehlich (2005) <doi:10.1109/INFVIS.2005.1532152> and Rosvall and Bergstrom (2010) <doi:10.1371/journal.pone.0008694>. Alluvial plots are statistical graphics in the sense of Wilkinson (2006) <doi:10.1007/0-387-28695-0>; they share elements with Sankey diagrams and parallel sets plots but are uniquely determined from the data and a small set of parameters. This package extends Wickham's (2010) <doi:10.1198/jcgs.2009.07098> layered grammar of graphics to generate alluvial plots from tidy data.
Maintained by Jason Cory Brunson. Last updated 8 months ago.
alluvial-diagramsalluvial-plotscategorical-data-visualizationggplot2repeated-measures-data
507 stars 14.14 score 3.0k scripts 21 dependentskassambara
factoextra:Extract and Visualize the Results of Multivariate Data Analyses
Provides some easy-to-use functions to extract and visualize the output of multivariate data analyses, including 'PCA' (Principal Component Analysis), 'CA' (Correspondence Analysis), 'MCA' (Multiple Correspondence Analysis), 'FAMD' (Factor Analysis of Mixed Data), 'MFA' (Multiple Factor Analysis) and 'HMFA' (Hierarchical Multiple Factor Analysis) functions from different R packages. It contains also functions for simplifying some clustering analysis steps and provides 'ggplot2' - based elegant data visualization.
Maintained by Alboukadel Kassambara. Last updated 5 years ago.
363 stars 14.13 score 15k scripts 52 dependentsbioc
GOSemSim:GO-terms Semantic Similarity Measures
The semantic comparisons of Gene Ontology (GO) annotations provide quantitative ways to compute similarities between genes and gene groups, and have became important basis for many bioinformatics analysis approaches. GOSemSim is an R package for semantic similarity computation among GO terms, sets of GO terms, gene products and gene clusters. GOSemSim implemented five methods proposed by Resnik, Schlicker, Jiang, Lin and Wang respectively.
Maintained by Guangchuang Yu. Last updated 5 months ago.
annotationgoclusteringpathwaysnetworksoftwarebioinformaticsgene-ontologysemantic-similaritycpp
63 stars 14.12 score 708 scripts 68 dependentsbioc
ensembldb:Utilities to create and use Ensembl-based annotation databases
The package provides functions to create and use transcript centric annotation databases/packages. The annotation for the databases are directly fetched from Ensembl using their Perl API. The functionality and data is similar to that of the TxDb packages from the GenomicFeatures package, but, in addition to retrieve all gene/transcript models and annotations from the database, ensembldb provides a filter framework allowing to retrieve annotations for specific entries like genes encoded on a chromosome region or transcript models of lincRNA genes. EnsDb databases built with ensembldb contain also protein annotations and mappings between proteins and their encoding transcripts. Finally, ensembldb provides functions to map between genomic, transcript and protein coordinates.
Maintained by Johannes Rainer. Last updated 5 months ago.
geneticsannotationdatasequencingcoverageannotationbioconductorbioconductor-packagesensembl
35 stars 14.08 score 892 scripts 108 dependentsbioc
qvalue:Q-value estimation for false discovery rate control
This package takes a list of p-values resulting from the simultaneous testing of many hypotheses and estimates their q-values and local FDR values. The q-value of a test measures the proportion of false positives incurred (called the false discovery rate) when that particular test is called significant. The local FDR measures the posterior probability the null hypothesis is true given the test's p-value. Various plots are automatically generated, allowing one to make sensible significance cut-offs. Several mathematical results have recently been shown on the conservative accuracy of the estimated q-values from this software. The software can be applied to problems in genomics, brain imaging, astrophysics, and data mining.
Maintained by John D. Storey. Last updated 5 months ago.
116 stars 14.07 score 3.0k scripts 139 dependentsteunbrand
ggh4x:Hacks for 'ggplot2'
A 'ggplot2' extension that does a variety of little helpful things. The package extends 'ggplot2' facets through customisation, by setting individual scales per panel, resizing panels and providing nested facets. Also allows multiple colour and fill scales per plot. Also hosts a smaller collection of stats, geoms and axis guides.
Maintained by Teun van den Brand. Last updated 12 days ago.
617 stars 14.06 score 4.4k scripts 21 dependentswalkerke
tidycensus:Load US Census Boundary and Attribute Data as 'tidyverse' and 'sf'-Ready Data Frames
An integrated R interface to several United States Census Bureau APIs (<https://www.census.gov/data/developers/data-sets.html>) and the US Census Bureau's geographic boundary files. Allows R users to return Census and ACS data as tidyverse-ready data frames, and optionally returns a list-column with feature geometry for mapping and spatial analysis.
Maintained by Kyle Walker. Last updated 2 months ago.
648 stars 14.02 score 7.5k scripts 10 dependentsr-lib
slider:Sliding Window Functions
Provides type-stable rolling window functions over any R data type. Cumulative and expanding windows are also supported. For more advanced usage, an index can be used as a secondary vector that defines how sliding windows are to be created.
Maintained by Davis Vaughan. Last updated 2 months ago.
302 stars 13.99 score 848 scripts 99 dependentstazinho
snakecase:Convert Strings into any Case
A consistent, flexible and easy to use tool to parse and convert strings into cases like snake or camel among others.
Maintained by Malte Grosser. Last updated 2 years ago.
camelcasecaseconversionpascalcasesnake-case
148 stars 13.98 score 744 scripts 288 dependentspharmaverse
admiral:ADaM in R Asset Library
A toolbox for programming Clinical Data Interchange Standards Consortium (CDISC) compliant Analysis Data Model (ADaM) datasets in R. ADaM datasets are a mandatory part of any New Drug or Biologics License Application submitted to the United States Food and Drug Administration (FDA). Analysis derivations are implemented in accordance with the "Analysis Data Model Implementation Guide" (CDISC Analysis Data Model Team, 2021, <https://www.cdisc.org/standards/foundational/adam>).
Maintained by Ben Straub. Last updated 6 days ago.
cdiscclinical-trialsopen-source
239 stars 13.97 score 486 scripts 4 dependentstidymodels
workflows:Modeling Workflows
Managing both a 'parsnip' model and a preprocessor, such as a model formula or recipe from 'recipes', can often be challenging. The goal of 'workflows' is to streamline this process by bundling the model alongside the preprocessor, all within the same object.
Maintained by Simon Couch. Last updated 1 months ago.
207 stars 13.97 score 876 scripts 43 dependentshughjonesd
huxtable:Easily Create and Style Tables for LaTeX, HTML and Other Formats
Creates styled tables for data presentation. Export to HTML, LaTeX, RTF, 'Word', 'Excel', and 'PowerPoint'. Simple, modern interface to manipulate borders, size, position, captions, colours, text styles and number formatting. Table cells can span multiple rows and/or columns. Includes a 'huxreg' function for creation of regression tables, and 'quick_*' one-liners to print data to a new document.
Maintained by David Hugh-Jones. Last updated 27 days ago.
htmlhuxtablelatexmicrosoft-wordpowerpointreproducible-researchtables
323 stars 13.93 score 1.9k scripts 16 dependentsjbkunst
highcharter:A Wrapper for the 'Highcharts' Library
A wrapper for the 'Highcharts' library including shortcut functions to plot R objects. 'Highcharts' <https://www.highcharts.com/> is a charting library offering numerous chart types with a simple configuration syntax.
Maintained by Joshua Kunst. Last updated 1 years ago.
highchartshtmlwidgetsshinyshiny-rvisualizationwrapper
725 stars 13.93 score 4.9k scripts 18 dependentshrbrmstr
hrbrthemes:Additional Themes, Theme Components and Utilities for 'ggplot2'
A compilation of extra 'ggplot2' themes, scales and utilities, including a spell check function for plot label fields and an overall emphasis on typography. A copy of the 'Google' font 'Roboto Condensed' is also included.
Maintained by Bob Rudis. Last updated 17 days ago.
data-visualizationdatavisualizationggplot-extensionggplot2ggplot2-scalesggplot2-themesvisualization
1.3k stars 13.92 score 13k scripts 15 dependentsbioc
phyloseq:Handling and analysis of high-throughput microbiome census data
phyloseq provides a set of classes and tools to facilitate the import, storage, analysis, and graphical display of microbiome census data.
Maintained by Paul J. McMurdie. Last updated 5 months ago.
immunooncologysequencingmicrobiomemetagenomicsclusteringclassificationmultiplecomparisongeneticvariability
600 stars 13.91 score 8.4k scripts 38 dependentsbioc
AnnotationHub:Client to access AnnotationHub resources
This package provides a client for the Bioconductor AnnotationHub web resource. The AnnotationHub web resource provides a central location where genomic files (e.g., VCF, bed, wig) and other resources from standard locations (e.g., UCSC, Ensembl) can be discovered. The resource includes metadata about each resource, e.g., a textual description, tags, and date of modification. The client creates and manages a local cache of files retrieved by the user, helping with quick and reproducible access.
Maintained by Bioconductor Package Maintainer. Last updated 5 months ago.
infrastructuredataimportguithirdpartyclientcore-packageu24ca289073
17 stars 13.88 score 2.7k scripts 104 dependentsgergness
srvyr:'dplyr'-Like Syntax for Summary Statistics of Survey Data
Use piping, verbs like 'group_by' and 'summarize', and other 'dplyr' inspired syntactic style when calculating summary statistics on survey data using functions from the 'survey' package.
Maintained by Greg Freedman Ellis. Last updated 2 months ago.
215 stars 13.88 score 1.8k scripts 15 dependentsbiomodhub
biomod2:Ensemble Platform for Species Distribution Modeling
Functions for species distribution modeling, calibration and evaluation, ensemble of models, ensemble forecasting and visualization. The package permits to run consistently up to 10 single models on a presence/absences (resp presences/pseudo-absences) dataset and to combine them in ensemble models and ensemble projections. Some bench of other evaluation and visualisation tools are also available within the package.
Maintained by Maya Guéguen. Last updated 3 days ago.
95 stars 13.85 score 536 scripts 7 dependentsrsheets
cellranger:Translate Spreadsheet Cell Ranges to Rows and Columns
Helper functions to work with spreadsheets and the "A1:D10" style of cell range specification.
Maintained by Jennifer Bryan. Last updated 7 years ago.
51 stars 13.84 score 80 scripts 843 dependentstidyverse
blob:A Simple S3 Class for Representing Vectors of Binary Data ('BLOBS')
R's raw vector is useful for storing a single binary object. What if you want to put a vector of them in a data frame? The 'blob' package provides the blob object, a list of raw vectors, suitable for use as a column in data frame.
Maintained by Kirill Müller. Last updated 4 months ago.
45 stars 13.82 score 157 scripts 1.4k dependentstidymodels
corrr:Correlations in R
A tool for exploring correlations. It makes it possible to easily perform routine tasks when exploring correlation matrices such as ignoring the diagonal, focusing on the correlations of certain variables against others, or rearranging and visualizing the matrix in terms of the strength of the correlations.
Maintained by Max Kuhn. Last updated 1 years ago.
593 stars 13.82 score 2.9k scripts 7 dependentsbioc
BiocFileCache:Manage Files Across Sessions
This package creates a persistent on-disk cache of files that the user can add, update, and retrieve. It is useful for managing resources (such as custom Txdb objects) that are costly or difficult to create, web resources, and data files used across sessions.
Maintained by Lori Shepherd. Last updated 2 months ago.
dataimportcore-packageu24ca289073
13 stars 13.76 score 486 scripts 436 dependentsbioc
mixOmics:Omics Data Integration Project
Multivariate methods are well suited to large omics data sets where the number of variables (e.g. genes, proteins, metabolites) is much larger than the number of samples (patients, cells, mice). They have the appealing properties of reducing the dimension of the data by using instrumental variables (components), which are defined as combinations of all variables. Those components are then used to produce useful graphical outputs that enable better understanding of the relationships and correlation structures between the different data sets that are integrated. mixOmics offers a wide range of multivariate methods for the exploration and integration of biological datasets with a particular focus on variable selection. The package proposes several sparse multivariate models we have developed to identify the key variables that are highly correlated, and/or explain the biological outcome of interest. The data that can be analysed with mixOmics may come from high throughput sequencing technologies, such as omics data (transcriptomics, metabolomics, proteomics, metagenomics etc) but also beyond the realm of omics (e.g. spectral imaging). The methods implemented in mixOmics can also handle missing values without having to delete entire rows with missing data. A non exhaustive list of methods include variants of generalised Canonical Correlation Analysis, sparse Partial Least Squares and sparse Discriminant Analysis. Recently we implemented integrative methods to combine multiple data sets: N-integration with variants of Generalised Canonical Correlation Analysis and P-integration with variants of multi-group Partial Least Squares.
Maintained by Eva Hamrud. Last updated 3 days ago.
immunooncologymicroarraysequencingmetabolomicsmetagenomicsproteomicsgenepredictionmultiplecomparisonclassificationregressionbioconductorgenomicsgenomics-datagenomics-visualizationmultivariate-analysismultivariate-statisticsomicsr-pkgr-project
185 stars 13.75 score 1.3k scripts 22 dependentsimmunogenomics
harmony:Fast, Sensitive, and Accurate Integration of Single Cell Data
Implementation of the Harmony algorithm for single cell integration, described in Korsunsky et al <doi:10.1038/s41592-019-0619-0>. Package includes a standalone Harmony function and interfaces to external frameworks.
Maintained by Ilya Korsunsky. Last updated 5 months ago.
algorithmdata-integrationscrna-seqopenblascpp
554 stars 13.74 score 5.5k scripts 8 dependentsricharddmorey
BayesFactor:Computation of Bayes Factors for Common Designs
A suite of functions for computing various Bayes factors for simple designs, including contingency tables, one- and two-sample designs, one-way designs, general ANOVA designs, and linear regression.
Maintained by Richard D. Morey. Last updated 1 years ago.
132 stars 13.71 score 1.7k scripts 21 dependentsknausb
vcfR:Manipulate and Visualize VCF Data
Facilitates easy manipulation of variant call format (VCF) data. Functions are provided to rapidly read from and write to VCF files. Once VCF data is read into R a parser function extracts matrices of data. This information can then be used for quality control or other purposes. Additional functions provide visualization of genomic data. Once processing is complete data may be written to a VCF file (*.vcf.gz). It also may be converted into other popular R objects (e.g., genlight, DNAbin). VcfR provides a link between VCF data and familiar R software.
Maintained by Brian J. Knaus. Last updated 1 months ago.
genomicspopulation-geneticspopulation-genomicsrcppvcf-datavisualizationzlibcpp
256 stars 13.66 score 3.1k scripts 19 dependentsaphalo
ggpmisc:Miscellaneous Extensions to 'ggplot2'
Extensions to 'ggplot2' respecting the grammar of graphics paradigm. Statistics: locate and tag peaks and valleys; label plot with the equation of a fitted polynomial or other types of models; labels with P-value, R^2 or adjusted R^2 or information criteria for fitted models; label with ANOVA table for fitted models; label with summary for fitted models. Model fit classes for which suitable methods are provided by package 'broom' and 'broom.mixed' are supported. Scales and stats to build volcano and quadrant plots based on outcomes, fold changes, p-values and false discovery rates.
Maintained by Pedro J. Aphalo. Last updated 2 days ago.
data-analysisdatavizggplot2-annotationsggplot2-statsstatistics
107 stars 13.64 score 4.4k scripts 14 dependentsropensci
taxize:Taxonomic Information from Around the Web
Interacts with a suite of web application programming interfaces (API) for taxonomic tasks, such as getting database specific taxonomic identifiers, verifying species names, getting taxonomic hierarchies, fetching downstream and upstream taxonomic names, getting taxonomic synonyms, converting scientific to common names and vice versa, and more. Some of the services supported include 'NCBI E-utilities' (<https://www.ncbi.nlm.nih.gov/books/NBK25501/>), 'Encyclopedia of Life' (<https://eol.org/docs/what-is-eol/data-services>), 'Global Biodiversity Information Facility' (<https://techdocs.gbif.org/en/openapi/>), and many more. Links to the API documentation for other supported services are available in the documentation for their respective functions in this package.
Maintained by Zachary Foster. Last updated 27 days ago.
taxonomybiologynomenclaturejsonapiwebapi-clientidentifiersspeciesnamesapi-wrapperbiodiversitydarwincoredatataxize
274 stars 13.63 score 1.6k scripts 23 dependentsrstudio
keras3:R Interface to 'Keras'
Interface to 'Keras' <https://keras.io>, a high-level neural networks API. 'Keras' was developed with a focus on enabling fast experimentation, supports both convolution based networks and recurrent networks (as well as combinations of the two), and runs seamlessly on both CPU and GPU devices.
Maintained by Tomasz Kalinowski. Last updated 11 days ago.
845 stars 13.63 score 264 scripts 2 dependentschristophergandrud
networkD3:D3 JavaScript Network Graphs from R
Creates 'D3' 'JavaScript' network, tree, dendrogram, and Sankey graphs from 'R'.
Maintained by Christopher Gandrud. Last updated 6 years ago.
654 stars 13.60 score 3.4k scripts 31 dependentsyulab-smu
scatterpie:Scatter Pie Plot
Creates scatterpie plots, especially useful for plotting pies on a map.
Maintained by Guangchuang Yu. Last updated 3 months ago.
62 stars 13.60 score 820 scripts 68 dependentsdieghernan
tidyterra:'tidyverse' Methods and 'ggplot2' Helpers for 'terra' Objects
Extension of the 'tidyverse' for 'SpatRaster' and 'SpatVector' objects of the 'terra' package. It includes also new 'geom_' functions that provide a convenient way of visualizing 'terra' objects with 'ggplot2'.
Maintained by Diego Hernangómez. Last updated 17 hours ago.
terraggplot-extensionr-spatialrspatial
190 stars 13.59 score 1.9k scripts 26 dependentskaz-yos
tableone:Create 'Table 1' to Describe Baseline Characteristics with or without Propensity Score Weights
Creates 'Table 1', i.e., description of baseline patient characteristics, which is essential in every medical research. Supports both continuous and categorical variables, as well as p-values and standardized mean differences. Weighted data are supported via the 'survey' package.
Maintained by Kazuki Yoshida. Last updated 3 years ago.
baseline-characteristicsdescriptive-statisticsstatistics
221 stars 13.55 score 2.3k scripts 12 dependentsandrie
ggdendro:Create Dendrograms and Tree Diagrams Using 'ggplot2'
This is a set of tools for dendrograms and tree plots using 'ggplot2'. The 'ggplot2' philosophy is to clearly separate data from the presentation. Unfortunately the plot method for dendrograms plots directly to a plot device without exposing the data. The 'ggdendro' package resolves this by making available functions that extract the dendrogram plot data. The package provides implementations for 'tree', 'rpart', as well as diana and agnes (from 'cluster') diagrams.
Maintained by Andrie de Vries. Last updated 4 months ago.
86 stars 13.54 score 3.9k scripts 62 dependentsmitchelloharawild
distributional:Vectorised Probability Distributions
Vectorised distribution objects with tools for manipulating, visualising, and using probability distributions. Designed to allow model prediction outputs to return distributions rather than their parameters, allowing users to directly interact with predictive distributions in a data-oriented workflow. In addition to providing generic replacements for p/d/q/r functions, other useful statistics can be computed including means, variances, intervals, and highest density regions.
Maintained by Mitchell OHara-Wild. Last updated 4 days ago.
probability-distributionstatisticsvctrs
100 stars 13.54 score 744 scripts 388 dependentstidyverts
fable:Forecasting Models for Tidy Time Series
Provides a collection of commonly used univariate and multivariate time series forecasting models including automatically selected exponential smoothing (ETS) and autoregressive integrated moving average (ARIMA) models. These models work within the 'fable' framework provided by the 'fabletools' package, which provides the tools to evaluate, visualise, and combine models in a workflow consistent with the tidyverse.
Maintained by Mitchell OHara-Wild. Last updated 4 months ago.
569 stars 13.54 score 2.1k scripts 6 dependentsasgr
imager:Image Processing Library Based on 'CImg'
Fast image processing for images in up to 4 dimensions (two spatial dimensions, one time/depth dimension, one colour dimension). Provides most traditional image processing tools (filtering, morphology, transformations, etc.) as well as various functions for easily analysing image data using R. The package wraps 'CImg', <http://cimg.eu>, a simple, modern C++ library for image processing.
Maintained by Aaron Robotham. Last updated 7 days ago.
17 stars 13.53 score 2.4k scripts 44 dependentsemilhvitfeldt
paletteer:Comprehensive Collection of Color Palettes
The choices of color palettes in R can be quite overwhelming with palettes spread over many packages with many different API's. This packages aims to collect all color palettes across the R ecosystem under the same package with a streamlined API.
Maintained by Emil Hvitfeldt. Last updated 9 months ago.
964 stars 13.53 score 6.9k scripts 23 dependentsbioc
GEOquery:Get data from NCBI Gene Expression Omnibus (GEO)
The NCBI Gene Expression Omnibus (GEO) is a public repository of microarray data. Given the rich and varied nature of this resource, it is only natural to want to apply BioConductor tools to these data. GEOquery is the bridge between GEO and BioConductor.
Maintained by Sean Davis. Last updated 5 months ago.
microarraydataimportonechanneltwochannelsagebioconductorbioinformaticsdata-sciencegenomicsncbi-geo
93 stars 13.48 score 4.1k scripts 45 dependentsbioc
RCy3:Functions to Access and Control Cytoscape
Vizualize, analyze and explore networks using Cytoscape via R. Anything you can do using the graphical user interface of Cytoscape, you can now do with a single RCy3 function.
Maintained by Alex Pico. Last updated 4 days ago.
visualizationgraphandnetworkthirdpartyclientnetwork
52 stars 13.47 score 628 scripts 17 dependentsdaattali
ggExtra:Add Marginal Histograms to 'ggplot2', and More 'ggplot2' Enhancements
Collection of functions and layers to enhance 'ggplot2'. The flagship function is 'ggMarginal()', which can be used to add marginal histograms/boxplots/density plots to 'ggplot2' scatterplots.
Maintained by Dean Attali. Last updated 10 months ago.
ggplot2ggplot2-enhancementsmarginal-plots
387 stars 13.45 score 3.3k scripts 28 dependentsphilchalmers
SimDesign:Structure for Organizing Monte Carlo Simulation Designs
Provides tools to safely and efficiently organize and execute Monte Carlo simulation experiments in R. The package controls the structure and back-end of Monte Carlo simulation experiments by utilizing a generate-analyse-summarise workflow. The workflow safeguards against common simulation coding issues, such as automatically re-simulating non-convergent results, prevents inadvertently overwriting simulation files, catches error and warning messages during execution, implicitly supports parallel processing with high-quality random number generation, and provides tools for managing high-performance computing (HPC) array jobs submitted to schedulers such as SLURM. For a pedagogical introduction to the package see Sigal and Chalmers (2016) <doi:10.1080/10691898.2016.1246953>. For a more in-depth overview of the package and its design philosophy see Chalmers and Adkins (2020) <doi:10.20982/tqmp.16.4.p248>.
Maintained by Phil Chalmers. Last updated 3 days ago.
monte-carlo-simulationsimulationsimulation-framework
62 stars 13.41 score 253 scripts 47 dependentsmodeloriented
DALEX:moDel Agnostic Language for Exploration and eXplanation
Any unverified black box model is the path to failure. Opaqueness leads to distrust. Distrust leads to ignoration. Ignoration leads to rejection. DALEX package xrays any model and helps to explore and explain its behaviour. Machine Learning (ML) models are widely used and have various applications in classification or regression. Models created with boosting, bagging, stacking or similar techniques are often used due to their high performance. But such black-box models usually lack direct interpretability. DALEX package contains various methods that help to understand the link between input variables and model output. Implemented methods help to explore the model on the level of a single instance as well as a level of the whole dataset. All model explainers are model agnostic and can be compared across different models. DALEX package is the cornerstone for 'DrWhy.AI' universe of packages for visual model exploration. Find more details in (Biecek 2018) <https://jmlr.org/papers/v19/18-416.html>.
Maintained by Przemyslaw Biecek. Last updated 2 months ago.
black-boxdalexdata-scienceexplainable-aiexplainable-artificial-intelligenceexplainable-mlexplanationsexplanatory-model-analysisfairnessimlinterpretabilityinterpretable-machine-learningmachine-learningmodel-visualizationpredictive-modelingresponsible-airesponsible-mlxai
1.4k stars 13.40 score 876 scripts 21 dependentsvpetukhov
ggrastr:Rasterize Layers for 'ggplot2'
Rasterize only specific layers of a 'ggplot2' plot while simultaneously keeping all labels and text in vector format. This allows users to keep plots within the reasonable size limit without loosing vector properties of the scale-sensitive information.
Maintained by Evan Biederstedt. Last updated 2 years ago.
220 stars 13.37 score 1.9k scripts 53 dependentsyulab-smu
tidytree:A Tidy Tool for Phylogenetic Tree Data Manipulation
Phylogenetic tree generally contains multiple components including node, edge, branch and associated data. 'tidytree' provides an approach to convert tree object to tidy data frame as well as provides tidy interfaces to manipulate tree data.
Maintained by Guangchuang Yu. Last updated 8 months ago.
phylogenetic-treetidyversetree-data
56 stars 13.36 score 584 scripts 128 dependentsbusiness-science
tidyquant:Tidy Quantitative Financial Analysis
Bringing business and financial analysis to the 'tidyverse'. The 'tidyquant' package provides a convenient wrapper to various 'xts', 'zoo', 'quantmod', 'TTR' and 'PerformanceAnalytics' package functions and returns the objects in the tidy 'tibble' format. The main advantage is being able to use quantitative functions with the 'tidyverse' functions including 'purrr', 'dplyr', 'tidyr', 'ggplot2', 'lubridate', etc. See the 'tidyquant' website for more information, documentation and examples.
Maintained by Matt Dancho. Last updated 2 months ago.
dplyrfinancial-analysisfinancial-datafinancial-statementsmultiple-stocksperformance-analysisperformanceanalyticsquantmodstockstock-exchangesstock-indexesstock-listsstock-performancestock-pricesstock-symboltidyversetime-seriestimeseriesxts
872 stars 13.34 score 5.2k scriptsprojectmosaic
mosaic:Project MOSAIC Statistics and Mathematics Teaching Utilities
Data sets and utilities from Project MOSAIC (<http://www.mosaic-web.org>) used to teach mathematics, statistics, computation and modeling. Funded by the NSF, Project MOSAIC is a community of educators working to tie together aspects of quantitative work that students in science, technology, engineering and mathematics will need in their professional lives, but which are usually taught in isolation, if at all.
Maintained by Randall Pruim. Last updated 1 years ago.
93 stars 13.32 score 7.2k scripts 7 dependentsropensci
visdat:Preliminary Visualisation of Data
Create preliminary exploratory data visualisations of an entire dataset to identify problems or unexpected features using 'ggplot2'.
Maintained by Nicholas Tierney. Last updated 9 months ago.
exploratory-data-analysismissingnesspeer-reviewedropenscivisualisation
452 stars 13.31 score 2.1k scripts 11 dependentschjackson
flexsurv:Flexible Parametric Survival and Multi-State Models
Flexible parametric models for time-to-event data, including the Royston-Parmar spline model, generalized gamma and generalized F distributions. Any user-defined parametric distribution can be fitted, given at least an R function defining the probability density or hazard. There are also tools for fitting and predicting from fully parametric multi-state models, based on either cause-specific hazards or mixture models.
Maintained by Christopher Jackson. Last updated 2 months ago.
57 stars 13.31 score 632 scripts 43 dependentsdreamrs
esquisse:Explore and Visualize Your Data Interactively
A 'shiny' gadget to create 'ggplot2' figures interactively with drag-and-drop to map your variables to different aesthetics. You can quickly visualize your data accordingly to their type, export in various formats, and retrieve the code to reproduce the plot.
Maintained by Victor Perrier. Last updated 1 months ago.
addindata-visualizationggplot2rstudio-addinvisualization
1.8k stars 13.31 score 1.1k scripts 1 dependentstrafficonese
leaflet.extras:Extra Functionality for 'leaflet' Package
The 'leaflet' JavaScript library provides many plugins some of which are available in the core 'leaflet' package, but there are many more. It is not possible to support them all in the core 'leaflet' package. This package serves as an add-on to the 'leaflet' package by providing extra functionality via 'leaflet' plugins.
Maintained by Sebastian Gatscha. Last updated 3 months ago.
data-visualizationgeospatialleaflet
218 stars 13.27 score 2.5k scripts 25 dependentsropensci
rgbif:Interface to the Global Biodiversity Information Facility API
A programmatic interface to the Web Service methods provided by the Global Biodiversity Information Facility (GBIF; <https://www.gbif.org/developer/summary>). GBIF is a database of species occurrence records from sources all over the globe. rgbif includes functions for searching for taxonomic names, retrieving information on data providers, getting species occurrence records, getting counts of occurrence records, and using the GBIF tile map service to make rasters summarizing huge amounts of data.
Maintained by John Waller. Last updated 18 days ago.
gbifspecimensapiweb-servicesoccurrencesspeciestaxonomybiodiversitydatalifewatchoscibiospocc
161 stars 13.26 score 2.1k scripts 20 dependentsguangchuangyu
ggplotify:Convert Plot to 'grob' or 'ggplot' Object
Convert plot function call (using expression or formula) to 'grob' or 'ggplot' object that compatible to the 'grid' and 'ggplot2' ecosystem. With this package, we are able to e.g. using 'cowplot' to align plots produced by 'base' graphics, 'ComplexHeatmap', 'eulerr', 'grid', 'lattice', 'magick', 'pheatmap', 'vcd' etc. by converting them to 'ggplot' objects.
Maintained by Guangchuang Yu. Last updated 1 years ago.
baseplotggplot2gridlatticeupsetrvcd
108 stars 13.23 score 2.0k scripts 174 dependentseasystats
see:Model Visualisation Toolbox for 'easystats' and 'ggplot2'
Provides plotting utilities supporting packages in the 'easystats' ecosystem (<https://github.com/easystats/easystats>) and some extra themes, geoms, and scales for 'ggplot2'. Color scales are based on <https://materialui.co/>. References: Lüdecke et al. (2021) <doi:10.21105/joss.03393>.
Maintained by Indrajeet Patil. Last updated 20 days ago.
data-visualizationeasystatsggplot2hacktoberfestplottingseestatisticsvisualisationvisualization
902 stars 13.22 score 2.0k scripts 3 dependentsoscarkjell
text:Analyses of Text using Transformers Models from HuggingFace, Natural Language Processing and Machine Learning
Link R with Transformers from Hugging Face to transform text variables to word embeddings; where the word embeddings are used to statistically test the mean difference between set of texts, compute semantic similarity scores between texts, predict numerical variables, and visual statistically significant words according to various dimensions etc. For more information see <https://www.r-text.org>.
Maintained by Oscar Kjell. Last updated 9 days ago.
deep-learningmachine-learningnlptransformersopenjdk
145 stars 13.21 score 436 scripts 1 dependentswadpac
GGIR:Raw Accelerometer Data Analysis
A tool to process and analyse data collected with wearable raw acceleration sensors as described in Migueles and colleagues (JMPB 2019), and van Hees and colleagues (JApplPhysiol 2014; PLoSONE 2015). The package has been developed and tested for binary data from 'GENEActiv' <https://activinsights.com/>, binary (.gt3x) and .csv-export data from 'Actigraph' <https://theactigraph.com> devices, and binary (.cwa) and .csv-export data from 'Axivity' <https://axivity.com>. These devices are currently widely used in research on human daily physical activity. Further, the package can handle accelerometer data file from any other sensor brand providing that the data is stored in csv format. Also the package allows for external function embedding.
Maintained by Vincent T van Hees. Last updated 17 days ago.
accelerometeractivity-recognitioncircadian-rhythmmovement-sensorsleep
109 stars 13.20 score 342 scripts 3 dependentsbioc
dada2:Accurate, high-resolution sample inference from amplicon sequencing data
The dada2 package infers exact amplicon sequence variants (ASVs) from high-throughput amplicon sequencing data, replacing the coarser and less accurate OTU clustering approach. The dada2 pipeline takes as input demultiplexed fastq files, and outputs the sequence variants and their sample-wise abundances after removing substitution and chimera errors. Taxonomic classification is available via a native implementation of the RDP naive Bayesian classifier, and species-level assignment to 16S rRNA gene fragments by exact matching.
Maintained by Benjamin Callahan. Last updated 5 months ago.
immunooncologymicrobiomesequencingclassificationmetagenomicsampliconbioconductorbioinformaticsmetabarcodingtaxonomycpp
487 stars 13.17 score 3.0k scripts 4 dependentsjacobkap
fastDummies:Fast Creation of Dummy (Binary) Columns and Rows from Categorical Variables
Creates dummy columns from columns that have categorical variables (character or factor types). You can also specify which columns to make dummies out of, or which columns to ignore. Also creates dummy rows from character, factor, and Date columns. This package provides a significant speed increase from creating dummy variables through model.matrix().
Maintained by Jacob Kaplan. Last updated 2 months ago.
binary-datadummy-columnsdummy-datadummy-rowsdummy-variable
38 stars 13.13 score 2.5k scripts 134 dependentsstan-dev
shinystan:Interactive Visual and Numerical Diagnostics and Posterior Analysis for Bayesian Models
A graphical user interface for interactive Markov chain Monte Carlo (MCMC) diagnostics and plots and tables helpful for analyzing a posterior sample. The interface is powered by the 'Shiny' web application framework from 'RStudio' and works with the output of MCMC programs written in any programming language (and has extended functionality for 'Stan' models fit using the 'rstan' and 'rstanarm' packages).
Maintained by Jonah Gabry. Last updated 3 years ago.
bayesianbayesian-data-analysisbayesian-inferencebayesian-methodsbayesian-statisticsmcmcshiny-appsstanstatistical-graphics
200 stars 13.13 score 1.6k scripts 15 dependentsrunehaubo
lmerTest:Tests in Linear Mixed Effects Models
Provides p-values in type I, II or III anova and summary tables for lmer model fits (cf. lme4) via Satterthwaite's degrees of freedom method. A Kenward-Roger method is also available via the pbkrtest package. Model selection methods include step, drop1 and anova-like tables for random effects (ranova). Methods for Least-Square means (LS-means) and tests of linear contrasts of fixed effects are also available.
Maintained by Rune Haubo Bojesen Christensen. Last updated 4 years ago.
52 stars 13.09 score 13k scripts 91 dependentslarmarange
ggstats:Extension to 'ggplot2' for Plotting Stats
Provides new statistics, new geometries and new positions for 'ggplot2' and a suite of functions to facilitate the creation of statistical plots.
Maintained by Joseph Larmarange. Last updated 21 days ago.
37 stars 13.08 score 190 scripts 156 dependents