Showing 32 of total 32 results (show query)
tidyverse
tidyr:Tidy Messy Data
Tools to help to create tidy data, where each column is a variable, each row is an observation, and each cell contains a single value. 'tidyr' contains tools for changing the shape (pivoting) and hierarchy (nesting and 'unnesting') of a dataset, turning deeply nested lists into rectangular data frames ('rectangling'), and extracting values out of string columns. It also includes tools for working with missing values (both implicit and explicit).
Maintained by Hadley Wickham. Last updated 25 days ago.
1.4k stars 22.88 score 168k scripts 5.5k dependents
r-forge
Matrix:Sparse and Dense Matrix Classes and Methods
A rich hierarchy of sparse and dense matrix classes, including general, symmetric, triangular, and diagonal matrices with numeric, logical, or pattern entries. Efficient methods for operating on such matrices, often wrapping the 'BLAS', 'LAPACK', and 'SuiteSparse' libraries.
Maintained by Martin Maechler. Last updated 19 days ago.
1 stars 17.23 score 33k scripts 12k dependents
bioc
ggtree:an R package for visualization of tree and annotation data
'ggtree' extends the 'ggplot2' plotting system which implemented the grammar of graphics. 'ggtree' is designed for visualization and annotation of phylogenetic trees and other tree-like structures with their annotation data.
Maintained by Guangchuang Yu. Last updated 5 months ago.
alignmentannotationclusteringdataimportmultiplesequencealignmentphylogeneticsreproducibleresearchsoftwarevisualizationannotationsggplot2phylogenetic-trees
864 stars 16.86 score 5.1k scripts 109 dependentsbioc
S4Vectors:Foundation of vector-like and list-like containers in Bioconductor
The S4Vectors package defines the Vector and List virtual classes and a set of generic functions that extend the semantic of ordinary vectors and lists in R. Package developers can easily implement vector-like or list-like objects as concrete subclasses of Vector or List. In addition, a few low-level concrete subclasses of general interest (e.g. DataFrame, Rle, Factor, and Hits) are implemented in the S4Vectors package itself (many more are implemented in the IRanges package and in other Bioconductor infrastructure packages).
Maintained by Hervé Pagès. Last updated 2 months ago.
infrastructuredatarepresentationbioconductor-packagecore-package
18 stars 16.05 score 1.0k scripts 1.9k dependentsbioc
GenomicDataCommons:NIH / NCI Genomic Data Commons Access
Programmatically access the NIH / NCI Genomic Data Commons RESTful service.
Maintained by Sean Davis. Last updated 2 months ago.
dataimportsequencingapi-clientbioconductorbioinformaticscancercore-servicesdata-sciencegenomicsncitcgavignette
87 stars 11.94 score 238 scripts 12 dependents
ropensci
drake:A Pipeline Toolkit for Reproducible Computation at Scale
A general-purpose computational engine for data analysis, drake rebuilds intermediate data objects when their dependencies change, and it skips work when the results are already up to date. Not every execution starts from scratch, there is native support for parallel and distributed computing, and completed projects have tangible evidence that they are reproducible. Extensive documentation, from beginner-friendly tutorials to practical examples and more, is available at the reference website <https://docs.ropensci.org/drake/> and the online manual <https://books.ropensci.org/drake/>.
Maintained by William Michael Landau. Last updated 4 months ago.
data-sciencedrakehigh-performance-computingmakefilepeer-reviewedpipelinereproducibilityreproducible-researchropensciworkflow
1.3k stars 11.49 score 1.7k scripts 1 dependents
markfairbanks
tidytable:Tidy Interface to 'data.table'
A tidy interface to 'data.table', giving users the speed of 'data.table' while using tidyverse-like syntax.
Maintained by Mark Fairbanks. Last updated 2 months ago.
460 stars 11.39 score 732 scripts 11 dependentsbioc
VariantAnnotation:Annotation of Genetic Variants
Annotate variants, compute amino acid coding changes, predict coding outcomes.
Maintained by Bioconductor Package Maintainer. Last updated 3 months ago.
dataimportsequencingsnpannotationgeneticsvariantannotationcurlbzip2xz-utilszlib
11.39 score 1.9k scripts 152 dependents
hadley
reshape:Flexibly Reshape Data
Flexibly restructure and aggregate data using just two functions: melt and cast.
Maintained by Hadley Wickham. Last updated 3 years ago.
9.83 score 21k scripts 231 dependents
edzer
intervals:Tools for Working with Points and Intervals
Tools for working with and comparing sets of points and intervals.
Maintained by Edzer Pebesma. Last updated 7 months ago.
11 stars 9.50 score 122 scripts 98 dependents
flr
FLCore:Core Package of FLR, Fisheries Modelling in R
Core classes and methods for FLR, a framework for fisheries modelling and management strategy simulation in R. Developed by a team of fisheries scientists in various countries. More information can be found at <http://flr-project.org/>.
Maintained by Iago Mosqueira. Last updated 8 days ago.
fisheriesflrfisheries-modelling
16 stars 8.78 score 956 scripts 23 dependents
insightsengineering
rbmi:Reference Based Multiple Imputation
Implements standard and reference based multiple imputation methods for continuous longitudinal endpoints (Gower-Page et al. (2022) <doi:10.21105/joss.04251>). In particular, this package supports deterministic conditional mean imputation and jackknifing as described in Wolbers et al. (2022) <doi:10.1002/pst.2234>, Bayesian multiple imputation as described in Carpenter et al. (2013) <doi:10.1080/10543406.2013.834911>, and bootstrapped maximum likelihood imputation as described in von Hippel and Bartlett (2021) <doi: 10.1214/20-STS793>.
Maintained by Isaac Gravestock. Last updated 1 months ago.
18 stars 8.76 score 33 scripts 1 dependents
mucollective
multiverse:Create 'multiverse analysis' in R
Implement 'multiverse' style analyses (Steegen S., Tuerlinckx F, Gelman A., Vanpaemal, W., 2016) <doi:10.1177/1745691616658637> to show the robustness of statistical inference. 'Multiverse analysis' is a philosophy of statistical reporting where paper authors report the outcomes of many different statistical analyses in order to show how fragile or robust their findings are. The 'multiverse' package (Sarma A., Kale A., Moon M., Taback N., Chevalier F., Hullman J., Kay M., 2021) <doi:10.31219/osf.io/yfbwm> allows users to concisely and flexibly implement 'multiverse-style' analysis, which involve declaring alternate ways of performing an analysis step, in R and R Notebooks.
Maintained by Abhraneel Sarma. Last updated 4 months ago.
62 stars 8.37 score 42 scripts
symengine
symengine:Interface to the 'SymEngine' Library
Provides an R interface to 'SymEngine' <https://github.com/symengine/>, a standalone 'C++' library for fast symbolic manipulation. The package has functionalities for symbolic computation like calculating exact mathematical expressions, solving systems of linear equations and code generation.
Maintained by Jialin Ma. Last updated 1 years ago.
26 stars 8.20 score 33 scripts 10 dependents
hesim-dev
hesim:Health Economic Simulation Modeling and Decision Analysis
A modular and computationally efficient R package for parameterizing, simulating, and analyzing health economic simulation models. The package supports cohort discrete time state transition models (Briggs et al. 1998) <doi:10.2165/00019053-199813040-00003>, N-state partitioned survival models (Glasziou et al. 1990) <doi:10.1002/sim.4780091106>, and individual-level continuous time state transition models (Siebert et al. 2012) <doi:10.1016/j.jval.2012.06.014>, encompassing both Markov (time-homogeneous and time-inhomogeneous) and semi-Markov processes. Decision uncertainty from a cost-effectiveness analysis is quantified with standard graphical and tabular summaries of a probabilistic sensitivity analysis (Claxton et al. 2005, Barton et al. 2008) <doi:10.1002/hec.985>, <doi:10.1111/j.1524-4733.2008.00358.x>. Use of C++ and data.table make individual-patient simulation, probabilistic sensitivity analysis, and incorporation of patient heterogeneity fast.
Maintained by Devin Incerti. Last updated 6 months ago.
health-economic-evaluationmicrosimulationsimulation-modelingcpp
67 stars 8.12 score 41 scripts
dusadrian
admisc:Adrian Dusa's Miscellaneous
Contains functions used across packages 'DDIwR', 'QCA' and 'venn'. Interprets and translates, factorizes and negates SOP - Sum of Products expressions, for both binary and multi-value crisp sets, and extracts information (set names, set values) from those expressions. Other functions perform various other checks if possibly numeric (even if all numbers reside in a character vector) and coerce to numeric, or check if the numbers are whole. It also offers, among many others, a highly versatile recoding routine and some more flexible alternatives to the base functions 'with()' and 'within()'. SOP simplification functions in this package use related minimization from package 'QCA', which is recommended to be installed despite not being listed in the Imports field, due to circular dependency issues.
Maintained by Adrian Dusa. Last updated 15 days ago.
2 stars 7.61 score 20 scripts 92 dependents
statisfactions
simpr:Flexible 'Tidyverse'-Friendly Simulations
A general, 'tidyverse'-friendly framework for simulation studies, design analysis, and power analysis. Specify data generation, define varying parameters, generate data, fit models, and tidy model results in a single pipeline, without needing loops or custom functions.
Maintained by Ethan Brown. Last updated 9 months ago.
43 stars 6.89 score 30 scripts
r-cas
caracas:Computer Algebra
Computer algebra via the 'SymPy' library (<https://www.sympy.org/>). This makes it possible to solve equations symbolically, find symbolic integrals, symbolic sums and other important quantities.
Maintained by Mikkel Meyer Andersen. Last updated 27 days ago.
24 stars 6.80 score 87 scripts 1 dependents
jojo-
mipfp:Multidimensional Iterative Proportional Fitting and Alternative Models
An implementation of the iterative proportional fitting (IPFP), maximum likelihood, minimum chi-square and weighted least squares procedures for updating a N-dimensional array with respect to given target marginal distributions (which, in turn can be multidimensional). The package also provides an application of the IPFP to simulate multivariate Bernoulli distributions.
Maintained by Johan Barthelemy. Last updated 4 years ago.
24 stars 6.77 score 86 scripts 3 dependents
gavinsimpson
coenocliner:Coenocline Simulation
Simulate species occurrence and abundances (counts) along gradients.
Maintained by Gavin L. Simpson. Last updated 4 years ago.
12 stars 6.03 score 15 scripts 1 dependents
shaunpwilkinson
insect:Informatic Sequence Classification Trees
Provides tools for probabilistic taxon assignment with informatic sequence classification trees. See Wilkinson et al (2018) <doi:10.7287/peerj.preprints.26812v1>.
Maintained by Shaun Wilkinson. Last updated 4 years ago.
14 stars 5.80 score 91 scriptsbioc
tidyCoverage:Extract and aggregate genomic coverage over features of interest
`tidyCoverage` framework enables tidy manipulation of collections of genomic tracks and features using `tidySummarizedExperiment` methods. It facilitates the extraction, aggregation and visualization of genomic coverage over individual or thousands of genomic loci, relying on `CoverageExperiment` and `AggregatedCoverage` classes. This accelerates the integration of genomic track data in genomic analysis workflows.
Maintained by Jacques Serizay. Last updated 5 months ago.
21 stars 5.80 score 6 scripts
eth-mds
ricu:Intensive Care Unit Data with R
Focused on (but not exclusive to) data sets hosted on PhysioNet (<https://physionet.org>), 'ricu' provides utilities for download, setup and access of intensive care unit (ICU) data sets. In addition to functions for running arbitrary queries against available data sets, a system for defining clinical concepts and encoding their representations in tabular ICU data is presented.
Maintained by Nicolas Bennett. Last updated 10 months ago.
39 stars 5.65 score 77 scripts
globalgov
messydates:A Flexible Class for Messy Dates
Contains a set of tools for constructing and coercing into and from the "mdate" class. This date class implements ISO 8601-2:2019(E) and allows regular dates to be annotated to express unspecified date components, approximate or uncertain date components, date ranges, and sets of dates. This is useful for describing and analysing temporal information, whether historical or recent, where date precision may vary.
Maintained by James Hollway. Last updated 8 days ago.
15 stars 5.18 score
brodieg
oshka:Recursive Quoted Language Expansion
Expands quoted language by recursively replacing any symbol that points to quoted language with the language it points to. The recursive process continues until only symbols that point to non-language objects remain. The resulting quoted language can then be evaluated normally. This differs from the traditional 'quote'/'eval' pattern because it resolves intermediate language objects that would interfere with evaluation.
Maintained by Brodie Gaslam. Last updated 7 years ago.
14 stars 5.15 score 9 scripts
mclements
ascii:Export R Objects to Several Markup Languages
Coerce R object to 'asciidoc', 'txt2tags', 'restructuredText', 'org', 'textile' or 'pandoc' syntax. Package comes with a set of drivers for 'Sweave'.
Maintained by Mark Clements. Last updated 1 years ago.
8 stars 5.04 score 161 scripts 1 dependents
peekxc
simplextree:Provides Tools for Working with General Simplicial Complexes
Provides an interface to a Simplex Tree data structure, which is a data structure aimed at enabling efficient manipulation of simplicial complexes of any dimension. The Simplex Tree data structure was originally introduced by Jean-Daniel Boissonnat and Clément Maria (2014) <doi:10.1007/s00453-014-9887-3>.
Maintained by Matt Piekenbrock. Last updated 1 years ago.
rcppsimplicial-complextopological-data-analysistopologycpp
15 stars 4.56 score 16 scripts 1 dependents
wrathematics
kazaam:Tools for Tall Distributed Matrices
Many data science problems reduce to operations on very tall, skinny matrices. However, sometimes these matrices can be so tall that they are difficult to work with, or do not even fit into main memory. One strategy to deal with such objects is to distribute their rows across several processors. To this end, we offer an 'S4' class for tall, skinny, distributed matrices, called the 'shaq'. We also provide many useful numerical methods and statistics operations for operating on these distributed objects. The naming is a bit "tongue-in-cheek", with the class a play on the fact that 'Shaquille' 'ONeal' ('Shaq') is very tall, and he starred in the film 'Kazaam'.
Maintained by Drew Schmidt. Last updated 8 years ago.
3.82 score 133 scripts
jeinbeck-code
npmlreg:Nonparametric Maximum Likelihood Estimation for Random Effect Models
Nonparametric maximum likelihood estimation or Gaussian quadrature for overdispersed generalized linear models and variance component models.
Maintained by Jochen Einbeck. Last updated 7 years ago.
3.26 score 30 scripts 1 dependents
byoungman
deform:Spatial Deformation and Dimension Expansion Gaussian Processes
Methods for fitting nonstationary Gaussian process models by spatial deformation, as introduced by Sampson and Guttorp (1992) <doi:10.1080/01621459.1992.10475181>, and by dimension expansion, as introduced by Bornn et al. (2012) <doi:10.1080/01621459.2011.646919>. Low-rank thin-plate regression splines, as developed in Wood, S.N. (2003) <doi:10.1111/1467-9868.00374>, are used to either transform co-ordinates or create new latent dimensions.
Maintained by Ben Youngman. Last updated 1 years ago.
1.00 score 2 scripts