Showing 14 of total 14 results (show query)
muschellij2
rscopus:Scopus Database 'API' Interface
Uses Elsevier 'Scopus' API <https://dev.elsevier.com/sc_apis.html> to download information about authors and their citations.
Maintained by John Muschelli. Last updated 1 days ago.
77 stars 9.67 score 124 scripts 3 dependents
tychobra
polished:Authentication and Hosting for 'shiny' Apps
Authentication, user administration, hosting, and additional infrastructure for 'shiny' apps. See <https://polished.tech> for additional documentation and examples.
Maintained by Andy Merlino. Last updated 14 days ago.
233 stars 8.09 score 75 scripts
correlaid
newsanchor:Client for the News API
Interface to gather news from the 'News API', based on a multilevel query <https://newsapi.org/>. A personal API key is required.
Maintained by Yannik Buhl. Last updated 5 years ago.
36 stars 6.70 score 40 scripts
alshum
rwunderground:R Interface to Weather Underground API
Tools for getting historical weather information and forecasts from wunderground.com. Historical weather and forecast data includes, but is not limited to, temperature, humidity, windchill, wind speed, dew point, heat index. Additionally, the weather underground weather API also includes information on sunrise/sunset, tidal conditions, satellite/webcam imagery, weather alerts, hurricane alerts and historical high/low temperatures.
Maintained by Eric Hare. Last updated 7 years ago.
weatherweather-dataweather-historyweather-underground
77 stars 6.20 score 83 scripts
mikkelvembye
AIscreenR:AI Screening Tools in R for Systematic Reviewing
Provides functions to conduct title and abstract screening in systematic reviews using large language models, such as the Generative Pre-trained Transformer (GPT) models from 'OpenAI' <https://platform.openai.com/>. These functions can enhance the quality of title and abstract screenings while reducing the total screening time significantly. In addition, the package includes tools for quality assessment of title and abstract screenings, as described in Vembye, Christensen, Mølgaard, and Schytt (2024) <DOI:10.31219/osf.io/yrhzm>.
Maintained by Mikkel H. Vembye. Last updated 3 months ago.
gptopenaiscreeningsystematic-review
10 stars 6.11 score 7 scripts
omniacsdao
Rnumerai:Interface to the Numerai Machine Learning Tournament API
Routines to interact with the Numerai Machine Learning Tournament API <https://numer.ai>. The functionality includes the ability to automatically download the current tournament data, submit predictions, and to get information for your user.
Maintained by Eric Hare. Last updated 3 years ago.
35 stars 5.53 score 39 scripts
simpar1471
openFDA:'openFDA' API
The 'openFDA' API facilitates access to U.S. Food and Drug Administration (FDA) data on drugs, devices, foodstuffs, tobacco, and more with 'httr2'. This package makes the API easily accessible, returning objects which the user can convert to JSON data and parse. Kass-Hout TA, Xu Z, Mohebbi M et al. (2016) <doi:10.1093/jamia/ocv153>.
Maintained by Simon Parker. Last updated 6 months ago.
1 stars 4.81 score 128 scripts
conjugateprior
twfy:Drive the API for TheyWorkForYou
An R wrapper around the API of TheyWorkForYou, a parliamentary monitoring site that scrapes and repackages Hansard (the UK's parliamentary record) and augments it with information from the Register of Members' Interests, election results, and voting records to provide a unified source of information about UK legislators and their activities. See <http://www.theyworkforyou.com> for details.
Maintained by Will Lowe. Last updated 6 years ago.
9 stars 4.65 score 3 scripts
moohan
octopusR:Interact with the 'Octopus Energy' API
A simple wrapper for the 'Octopus Energy' REST API <https://developer.octopus.energy/rest/>. It handles authentication, by storing a provided API key and meter details. Implemented endpoints include 'products' for viewing tariff details and 'consumption' for viewing meter consumption data.
Maintained by James McMahon. Last updated 10 days ago.
4 stars 4.45 score 5 scripts
brianweinstein
googlenlp:An Interface to Google's Cloud Natural Language API
Interact with Google's Cloud Natural Language API <https://cloud.google.com/natural-language/> (v1) via R. The API has four main features, all of which are available through this R package: syntax analysis and part-of-speech tagging, entity analysis, sentiment analysis, and language identification.
Maintained by Brian Weinstien. Last updated 7 years ago.
9 stars 3.91 score 18 scripts
datawookie
clockify:A Wrapper for the 'Clockify' API
A wrapper for the Clockify API <https://docs.clockify.me/>, making it possible to query, insert and update time keeping data.
Maintained by Andrew B. Collier. Last updated 10 months ago.
1 stars 3.65 score 6 scripts
datarapi
Rapi:Interface for Multiple Data Providers `EDDS` and `FRED`
Interface for multiple data sources, such as the `EDDS` API <https://evds2.tcmb.gov.tr/index.php?/evds/userDocs> of the Central Bank of the Republic of Türkiye and the `FRED` API <https://fred.stlouisfed.org/docs/api/fred/> of the Federal Reserve Bank. Both data providers require API keys for access, which users can easily obtain by creating accounts on their respective websites. The package provides caching ability with the selection of periods to increase the speed and efficiency of requests. It combines datasets requested from different sources, helping users when the data has common frequencies. While combining data frames whenever possible, it also keeps all requested data available as separate data frames to increase efficiency.
Maintained by Sermet Pekin. Last updated 3 months ago.
eddsevdsevds-apievdsapifredcpp
1 stars 3.40 score 5 scripts
environmentalscienceassociates
fulcrumr:R Interface to Fulcrum API
R interface to Fulcrum API. Currently, only interfaces with Fulcrum Query API.
Maintained by Travis Hinkelman. Last updated 2 years ago.
1.70 score
ip2whois
ip2whois:Lookup 'WHOIS' Information for a Particular Domain
Easily implement the checking of 'WHOIS' information for a particular domain. 'IP2WHOIS' supports the query for 1113 Top-level Domains(TLDs) and 634 Country Code Top-level Domains(ccTLDs). To get started with a free API key, you may sign up at here <https://www.ip2whois.com/register>.
Maintained by IP2WHOIS. Last updated 5 months ago.
1.00 score