Showing 78 of total 78 results (show query)
tidyverse
blob:A Simple S3 Class for Representing Vectors of Binary Data ('BLOBS')
R's raw vector is useful for storing a single binary object. What if you want to put a vector of them in a data frame? The 'blob' package provides the blob object, a list of raw vectors, suitable for use as a column in data frame.
Maintained by Kirill Müller. Last updated 3 months ago.
71.4 match 45 stars 13.82 score 157 scripts 1.4k dependents
azure
AzureStor:Storage Management in 'Azure'
Manage storage in Microsoft's 'Azure' cloud: <https://azure.microsoft.com/en-us/product-categories/storage/>. On the admin side, 'AzureStor' includes features to create, modify and delete storage accounts. On the client side, it includes an interface to blob storage, file storage, and 'Azure Data Lake Storage Gen2': upload and download files and blobs; list containers and files/blobs; create containers; and so on. Authenticated access to storage is supported, via either a shared access key or a shared access signature (SAS). Part of the 'AzureR' family of packages.
Maintained by Hong Ooi. Last updated 2 years ago.
azure-data-lakeazure-sdk-razure-storageazure-storage-blobazure-storage-file
24.2 match 64 stars 10.72 score 298 scripts 4 dependents
ropensci
git2r:Provides Access to Git Repositories
Interface to the 'libgit2' library, which is a pure C implementation of the 'Git' core methods. Provides access to 'Git' repositories to extract data and running some basic 'Git' commands.
Maintained by Stefan Widgren. Last updated 12 days ago.
gitgit-clientlibgit2libgit2-library
14.0 match 218 stars 13.86 score 836 scripts 49 dependents
acorg
Racmacs:Antigenic Cartography Macros
A toolkit for making antigenic maps from immunological assay data, in order to quantify and visualize antigenic differences between different pathogen strains as described in Smith et al. (2004) <doi:10.1126/science.1097211> and used in the World Health Organization influenza vaccine strain selection process. Additional functions allow for the diagnostic evaluation of antigenic maps and an interactive viewer is provided to explore antigenic relationships amongst several strains and incorporate the visualization of associated genetic information.
Maintained by Sam Wilks. Last updated 9 months ago.
15.4 match 21 stars 8.06 score 362 scripts
poissonconsulting
dbflobr:Read and Write Files to SQLite Databases
Reads and writes files to SQLite databases <https://www.sqlite.org/index.html> as flobs (a flob is a blob that preserves the file extension).
Maintained by Evan Amies-Galonski. Last updated 2 months ago.
13.5 match 6 stars 5.86 score 5 scriptspoissonconsulting
flobr:Convert Files to and from Binary Objects (BLOBs)
Converts files to and from flobs. A flob is a file that was read into binary in integer-mode as little endian, saved as the single element of a named list (where the name is the name of the original file) and then serialized before being coerced into a blob. Flobs are useful for writing and reading files to and from databases.
Maintained by Evan Amies-Galonski. Last updated 2 months ago.
14.5 match 10 stars 5.33 score 12 scripts 1 dependents
crj32
Spectrum:Fast Adaptive Spectral Clustering for Single and Multi-View Data
A self-tuning spectral clustering method for single or multi-view data. 'Spectrum' uses a new type of adaptive density aware kernel that strengthens connections in the graph based on common nearest neighbours. It uses a tensor product graph data integration and diffusion procedure to integrate different data sources and reduce noise. 'Spectrum' uses either the eigengap or multimodality gap heuristics to determine the number of clusters. The method is sufficiently flexible so that a wide range of Gaussian and non-Gaussian structures can be clustered with automatic selection of K.
Maintained by Christopher R John. Last updated 5 years ago.
12.7 match 7 stars 5.99 score 47 scripts 1 dependents
md-anderson-bioinformatics
NGCHM:Next Generation Clustered Heat Maps
Next-Generation Clustered Heat Maps (NG-CHMs) allow for dynamic exploration of heat map data in a web browser. 'NGCHM' allows users to create both stand-alone HTML files containing a Next-Generation Clustered Heat Map, and .ngchm files to view in the NG-CHM viewer. See Ryan MC, Stucky M, et al (2020) <doi:10.12688/f1000research.20590.2> for more details.
Maintained by Mary A Rohrdanz. Last updated 9 days ago.
12.8 match 9 stars 5.48 score 28 scripts
alexjcwitsil
imagefx:Extract Features from Images
Synthesize images into characteristic features for time-series analysis or machine learning applications. The package was originally intended for monitoring volcanic eruptions in video data by highlighting and extracting regions above the vent associated with plume activity. However, the functions within are general and have wide applications for image processing, analyzing, filtering, and plotting.
Maintained by Alex J.C. Witsil. Last updated 5 years ago.
15.9 match 2.34 score 11 scripts
wavx
bioacoustics:Analyse Audio Recordings and Automatically Extract Animal Vocalizations
Contains all the necessary tools to process audio recordings of various formats (e.g., WAV, WAC, MP3, ZC), filter noisy files, display audio signals, detect and extract automatically acoustic features for further analysis such as classification.
Maintained by Jean Marchal. Last updated 1 years ago.
4.7 match 47 stars 7.71 score 72 scripts 5 dependents
danlwarren
ENMTools:Analysis of Niche Evolution using Niche and Distribution Models
Constructing niche models and analyzing patterns of niche evolution. Acts as an interface for many popular modeling algorithms, and allows users to conduct Monte Carlo tests to address basic questions in evolutionary ecology and biogeography. Warren, D.L., R.E. Glor, and M. Turelli (2008) <doi:10.1111/j.1558-5646.2008.00482.x> Glor, R.E., and D.L. Warren (2011) <doi:10.1111/j.1558-5646.2010.01177.x> Warren, D.L., R.E. Glor, and M. Turelli (2010) <doi:10.1111/j.1600-0587.2009.06142.x> Cardillo, M., and D.L. Warren (2016) <doi:10.1111/geb.12455> D.L. Warren, L.J. Beaumont, R. Dinnage, and J.B. Baumgartner (2019) <doi:10.1111/ecog.03900>.
Maintained by Dan Warren. Last updated 2 months ago.
4.9 match 105 stars 6.91 score 126 scripts
zejiang-unsw
synthesis:Generate Synthetic Data from Statistical Models
Generate synthetic time series from commonly used statistical models, including linear, nonlinear and chaotic systems. Applications to testing methods can be found in Jiang, Z., Sharma, A., & Johnson, F. (2019) <doi:10.1016/j.advwatres.2019.103430> and Jiang, Z., Sharma, A., & Johnson, F. (2020) <doi:10.1029/2019WR026962> associated with an open-source tool by Jiang, Z., Rashid, M. M., Johnson, F., & Sharma, A. (2020) <doi:10.1016/j.envsoft.2020.104907>.
Maintained by Ze Jiang. Last updated 9 months ago.
6.3 match 3 stars 4.56 score 12 scripts
appsilon
semantic.dashboard:Dashboard with Fomantic UI Support for Shiny
It offers functions for creating dashboard with Fomantic UI.
Maintained by Developers Appsilon. Last updated 11 months ago.
dashboardfomantic-uirhinoversesemantic-uishiny
3.2 match 255 stars 8.62 score 232 scripts
canmod
iidda:Processing Infectious Disease Datasets in IIDDA.
Part of an open toolchain for processing infectious disease datasets available through the IIDDA data repository.
Maintained by Steve Walker. Last updated 4 months ago.
4.5 match 6.07 score 133 scripts 3 dependents
benbruyneel
proteinDiscover:ProteinDiscover
Provides an interface to the data contained in Proteome Discoverer (Thermo Scientific) results.
Maintained by Ben Bruyneel. Last updated 1 years ago.
mass-spectrometryproteomicsproteomics-data-analysis
6.5 match 2 stars 3.00 score 2 scripts
cynkra
constructive:Display Idiomatic Code to Construct Most R Objects
Prints code that can be used to recreate R objects. In a sense it is similar to 'base::dput()' or 'base::deparse()' but 'constructive' strives to use idiomatic constructors.
Maintained by Antoine Fabri. Last updated 2 days ago.
1.9 match 137 stars 8.63 score 20 scriptsazure
azuremlsdk:Interface to the 'Azure Machine Learning' 'SDK'
Interface to the 'Azure Machine Learning' Software Development Kit ('SDK'). Data scientists can use the 'SDK' to train, deploy, automate, and manage machine learning models on the 'Azure Machine Learning' service. To learn more about 'Azure Machine Learning' visit the website: <https://docs.microsoft.com/en-us/azure/machine-learning/service/overview-what-is-azure-ml>.
Maintained by Diondra Peck. Last updated 3 years ago.
amlcomputeazureazure-machine-learningazuremldsimachine-learningrstudiosdk-r
1.8 match 106 stars 8.91 score 221 scripts
cran
notebookutils:Dummy R APIs Used in 'Azure Synapse Analytics' for Local Developments
This is a pure dummy interfaces package which mirrors 'MsSparkUtils' APIs <https://learn.microsoft.com/en-us/azure/synapse-analytics/spark/microsoft-spark-utilities?pivots=programming-language-r> of 'Azure Synapse Analytics' <https://learn.microsoft.com/en-us/azure/synapse-analytics/> for R users, customer of Azure Synapse can download this package from CRAN for local development.
Maintained by runtimeexp. Last updated 11 months ago.
6.5 match 2.36 score 23 scripts
asgr
imager:Image Processing Library Based on 'CImg'
Fast image processing for images in up to 4 dimensions (two spatial dimensions, one time/depth dimension, one colour dimension). Provides most traditional image processing tools (filtering, morphology, transformations, etc.) as well as various functions for easily analysing image data using R. The package wraps 'CImg', <http://cimg.eu>, a simple, modern C++ library for image processing.
Maintained by Aaron Robotham. Last updated 27 days ago.
1.1 match 17 stars 13.62 score 2.4k scripts 45 dependents
bioc
rawrr:Direct Access to Orbitrap Data and Beyond
This package wraps the functionality of the Thermo Fisher Scientic RawFileReader .NET 8.0 assembly. Within the R environment, spectra and chromatograms are represented by S3 objects. The package provides basic functions to download and install the required third-party libraries. The package is developed, tested, and used at the Functional Genomics Center Zurich, Switzerland.
Maintained by Christian Panse. Last updated 3 months ago.
massspectrometryproteomicsmetabolomicsinfrastructuresoftwarefastmass-spectrometrymultiplatformorbitrap-ms
1.8 match 56 stars 8.19 score 23 scripts 2 dependents
pik-piam
mip:Comparison of multi-model runs
Package contains generic functions to produce comparison plots of multi-model runs.
Maintained by David Klein. Last updated 26 days ago.
1.6 match 1 stars 8.08 score 70 scripts 20 dependents
stevenmmortimer
salesforcer:An Implementation of 'Salesforce' APIs Using Tidy Principles
Functions connecting to the 'Salesforce' Platform APIs (REST, SOAP, Bulk 1.0, Bulk 2.0, Metadata, Reports and Dashboards) <https://trailhead.salesforce.com/content/learn/modules/api_basics/api_basics_overview>. "API" is an acronym for "application programming interface". Most all calls from these APIs are supported as they use CSV, XML or JSON data that can be parsed into R data structures. For more details please see the 'Salesforce' API documentation and this package's website <https://stevenmmortimer.github.io/salesforcer/> for more information, documentation, and examples.
Maintained by Steven M. Mortimer. Last updated 4 months ago.
api-wrappersr-languager-programmingsalesforcesalesforce-apis
1.3 match 82 stars 9.27 score 191 scripts
christopherkenny
bskyr:Interact with 'Bluesky' Social
Collect data from and make posts on 'Bluesky' Social via the Hypertext Transfer Protocol (HTTP) Application Programming Interface (API), as documented at <https://atproto.com/specs/xrpc>. This further supports broader queries to the Authenticated Transfer (AT) Protocol <https://atproto.com/> which 'Bluesky' Social relies on. Data is returned in a tidy format and posts can be made using a simple interface.
Maintained by Christopher T. Kenny. Last updated 1 months ago.
2.0 match 20 stars 5.66 score 23 scripts
rstudio
graphframes:Interface for 'GraphFrames'
A 'sparklyr' <https://spark.rstudio.com/> extension that provides an R interface for 'GraphFrames' <https://graphframes.github.io/>. 'GraphFrames' is a package for 'Apache Spark' that provides a DataFrame-based API for working with graphs. Functionality includes motif finding and common graph algorithms, such as PageRank and Breadth-first search.
Maintained by Kevin Kuo. Last updated 6 years ago.
graphframesgraphspageranksparksparklyr
2.0 match 38 stars 5.20 score 84 scriptsropensci
tracerer:Tracer from R
'BEAST2' (<https://www.beast2.org>) is a widely used Bayesian phylogenetic tool, that uses DNA/RNA/protein data and many model priors to create a posterior of jointly estimated phylogenies and parameters. 'Tracer' (<https://github.com/beast-dev/tracer/>) is a GUI tool to parse and analyze the files generated by 'BEAST2'. This package provides a way to parse and analyze 'BEAST2' input files without active user input, but using R function calls instead.
Maintained by Richèl J.C. Bilderbeek. Last updated 1 years ago.
1.6 match 8 stars 6.49 score 86 scripts 3 dependents
kbroman
qtlcharts:Interactive Graphics for QTL Experiments
Web-based interactive charts (using D3.js) for the analysis of experimental crosses to identify genetic loci (quantitative trait loci, QTL) contributing to variation in quantitative traits. Broman (2015) <doi:10.1534/genetics.114.172742>.
Maintained by Karl W Broman. Last updated 2 years ago.
1.5 match 84 stars 6.61 score 322 scripts
bart1
move:Visualizing and Analyzing Animal Track Data
Contains functions to access movement data stored in 'movebank.org' as well as tools to visualize and statistically analyze animal movement data, among others functions to calculate dynamic Brownian Bridge Movement Models. Move helps addressing movement ecology questions.
Maintained by Bart Kranstauber. Last updated 4 months ago.
1.1 match 8.74 score 690 scripts 3 dependents
hsonne
findblobs:R Package to Find Connected Cells (Blobs) in a Matrix of Logical
This package provides functions to find blobs of connected cells in a matrix of logical. This is also known as Blob Colouring.
Maintained by Hauke Sonnenberg. Last updated 3 years ago.
5.6 match 1.70 score
welch-lab
cytosignal:What the Package Does (One Line, Title Case)
What the package does (one paragraph).
Maintained by Jialin Liu. Last updated 6 days ago.
1.5 match 16 stars 5.95 score 6 scriptsbioc
AnVILAz:R / Bioconductor Support for the AnVIL Azure Platform
The AnVIL is a cloud computing resource developed in part by the National Human Genome Research Institute. The AnVILAz package supports end-users and developers using the AnVIL platform in the Azure cloud. The package provides a programmatic interface to AnVIL resources, including workspaces, notebooks, tables, and workflows. The package also provides utilities for managing resources, including copying files to and from Azure Blob Storage, and creating shared access signatures (SAS) for secure access to Azure resources.
Maintained by Marcel Ramos. Last updated 5 months ago.
softwareinfrastructurethirdpartyclient
1.7 match 5.45 score 5 scripts
maarten14c
rbacon:Age-Depth Modelling using Bayesian Statistics
An approach to age-depth modelling that uses Bayesian statistics to reconstruct accumulation histories for deposits, through combining radiocarbon and other dates with prior information on accumulation rates and their variability. See Blaauw & Christen (2011).
Maintained by Maarten Blaauw. Last updated 26 days ago.
age-depth-modelbayesianholocenelakesocean-sedimentspeatradiocarbon-calibrationcpp
1.3 match 7 stars 6.75 score 57 scripts 1 dependents
michaelhallquist
ggbrain:Create Images of Volumetric Brain Data in NIfTI Format Using 'ggplot2' Syntax
A 'ggplot2'-consistent approach to generating 2D displays of volumetric brain imaging data. Display data from multiple NIfTI images using standard 'ggplot2' conventions such scales, limits, and themes to control the appearance of displays. The resulting plots are returned as 'patchwork' objects, inheriting from 'ggplot', allowing for any standard modifications of display aesthetics supported by 'ggplot2'.
Maintained by Michael Hallquist. Last updated 25 days ago.
1.7 match 2 stars 5.03 score 18 scripts
lrberge
fixest:Fast Fixed-Effects Estimations
Fast and user-friendly estimation of econometric models with multiple fixed-effects. Includes ordinary least squares (OLS), generalized linear models (GLM) and the negative binomial. The core of the package is based on optimized parallel C++ code, scaling especially well for large data sets. The method to obtain the fixed-effects coefficients is based on Berge (2018) <https://github.com/lrberge/fixest/blob/master/_DOCS/FENmlm_paper.pdf>. Further provides tools to export and view the results of several estimations with intuitive design to cluster the standard-errors.
Maintained by Laurent Berge. Last updated 7 months ago.
0.5 match 387 stars 14.69 score 3.8k scripts 25 dependentspoissonconsulting
subfoldr2:Save and Load R Objects
Facilitates saving and loading R objects, data frames, tables, plots, text blocks and numbers to subfolders.
Maintained by Joe Thorley. Last updated 14 days ago.
2.0 match 2 stars 3.70 score 5 scripts
cloudyr
aws.kms:'AWS Key Management Service' Client Package
Client package for the 'AWS Key Management Service' <https://aws.amazon.com/kms/>, a cloud service for managing encryption keys.
Maintained by Simon Urbanek. Last updated 5 years ago.
2.0 match 3.18 score 7 scripts
jdwor
vesselr:Gradient and Vesselness Tools for Arrays and NIfTI Images
Simple functions for calculating the image gradient, image hessian, volume ratio filter, and Frangi vesselness filter of 3-dimensional volumes.
Maintained by Jordan D. Dworkin. Last updated 8 years ago.
2.0 match 2 stars 3.00 score 4 scripts
abusjahn
wrappedtools:Useful Wrappers Around Commonly Used Functions
The main functionalities of 'wrappedtools' are: adding backticks to variable names; rounding to desired precision with special case for p-values; selecting columns based on pattern and storing their position, name, and backticked name; computing and formatting of descriptive statistics (e.g. mean±SD), comparing groups and creating publication-ready tables with descriptive statistics and p-values; creating specialized plots for correlation matrices. Functions were mainly written for my own daily work or teaching, but may be of use to others as well.
Maintained by Andreas Busjahn. Last updated 5 months ago.
descriptive-statisticstest-statistic
1.1 match 2 stars 4.70 score 8 scripts
hauselin
ollamar:'Ollama' Language Models
An interface to easily run local language models with 'Ollama' <https://ollama.com> server and API endpoints (see <https://github.com/ollama/ollama/blob/main/docs/api.md> for details). It lets you run open-source large language models locally on your machine.
Maintained by Hause Lin. Last updated 2 months ago.
0.5 match 84 stars 9.36 score 74 scripts 5 dependents
zcolburn
Bioi:Biological Image Analysis
Single linkage clustering and connected component analyses are often performed on biological images. 'Bioi' provides a set of functions for performing these tasks. This functionality is implemented in several key functions that can extend to from 1 to many dimensions. The single linkage clustering method implemented here can be used on n-dimensional data sets, while connected component analyses are limited to 3 or fewer dimensions.
Maintained by Zachary Colburn. Last updated 5 years ago.
biological-data-analysisbiologycellcppimage-analysismicroscopycpp
1.1 match 3.81 score 13 scriptscran
AntibodyForests:Delineating Inter- And Intra-Antibody Repertoire Evolution
The generated wealth of immune repertoire sequencing data requires software to investigate and quantify inter- and intra-antibody repertoire evolution to uncover how B cells evolve during immune responses. Here, we present 'AntibodyForests', a software to investigate and quantify inter- and intra-antibody repertoire evolution.
Maintained by Daphne van Ginneken. Last updated 2 months ago.
1.5 match 2.70 score 2 scripts
somalogic
SomaDataIO:Input/Output 'SomaScan' Data
Load and export 'SomaScan' data via the 'Standard BioTools, Inc.' structured text file called an ADAT ('*.adat'). For file format see <https://github.com/SomaLogic/SomaLogic-Data/blob/main/README.md>. The package also exports auxiliary functions for manipulating, wrangling, and extracting relevant information from an ADAT object once in memory.
Maintained by Caleb Scheidel. Last updated 1 months ago.
adatproteomicsproteomics-data-analysissomascan
0.5 match 26 stars 7.71 score 132 scripts
tjmahr
solarizeddocx:A 'Solarized' Theme for 'RMarkdown` `Docx` Documents
An 'RMarkdown' output format for 'Microsoft' Word '.docx' documents created by 'pandoc'.
Maintained by Tristan Mahr. Last updated 3 years ago.
1.5 match 7 stars 2.54 score 1 scripts
kylegrealis
froggeR:Enhance 'Quarto' Project Workflows and Standards
Streamlines 'Quarto' workflows by providing tools for consistent project setup and documentation. Enables portability through reusable metadata, automated project structure creation, and standardized templates. Features include enhanced project initialization, pre-formatted 'Quarto' documents, comprehensive data protection settings, custom styling, and structured documentation generation. Designed to improve efficiency and collaboration in R data science projects by reducing repetitive setup tasks while maintaining consistent formatting across multiple documents. There are many valuable resources providing in-depth explanations of customizing 'Quarto' templates and theme styling by the Posit team: <https://quarto.org/docs/output-formats/html-themes.html#customizing-themes> & <https://quarto.org/docs/output-formats/html-themes-more.html>, and at the Bootstrap community's GitHub at <https://github.com/twbs/bootstrap/blob/main/scss/_variables.scss>.
Maintained by Kyle Grealis. Last updated 3 hours ago.
data-scienceproject-managementquarto
0.5 match 26 stars 6.67 score 6 scripts
r-forge
TailRank:The Tail-Rank Statistic
Implements the tail-rank statistic for selecting biomarkers from a microarray data set, an efficient nonparametric test focused on the distributional tails. See <https://gitlab.com/krcoombes/coombeslab/-/blob/master/doc/papers/tolstoy-new.pdf>.
Maintained by Kevin R. Coombes. Last updated 1 months ago.
0.5 match 6.38 score 37 scripts 3 dependents
bnosac
BTM:Biterm Topic Models for Short Text
Biterm Topic Models find topics in collections of short texts. It is a word co-occurrence based topic model that learns topics by modeling word-word co-occurrences patterns which are called biterms. This in contrast to traditional topic models like Latent Dirichlet Allocation and Probabilistic Latent Semantic Analysis which are word-document co-occurrence topic models. A biterm consists of two words co-occurring in the same short text window. This context window can for example be a twitter message, a short answer on a survey, a sentence of a text or a document identifier. The techniques are explained in detail in the paper 'A Biterm Topic Model For Short Text' by Xiaohui Yan, Jiafeng Guo, Yanyan Lan, Xueqi Cheng (2013) <https://github.com/xiaohuiyan/xiaohuiyan.github.io/blob/master/paper/BTM-WWW13.pdf>.
Maintained by Jan Wijffels. Last updated 2 years ago.
biterm-topic-modellingnatural-language-processingtopic-modelingcpp
0.5 match 96 stars 6.25 score 74 scripts
miraisolutions
rTRNG:Advanced and Parallel Random Number Generation via 'TRNG'
Embeds sources and headers from Tina's Random Number Generator ('TRNG') C++ library. Exposes some functionality for easier access, testing and benchmarking into R. Provides examples of how to use parallel RNG with 'RcppParallel'. The methods and techniques behind 'TRNG' are illustrated in the package vignettes and examples. Full documentation is available in Bauke (2021) <https://github.com/rabauke/trng4/blob/v4.23.1/doc/trng.pdf>.
Maintained by Riccardo Porreca. Last updated 1 years ago.
0.5 match 19 stars 5.63 score 15 scripts
millerlp
rtide:Tide Heights
Calculates tide heights based on tide station harmonics. It includes the harmonics data for 637 US stations. The harmonics data was converted from <https://github.com/poissonconsulting/rtide/blob/main/data-raw/harmonics-dwf-20151227-free.tar.bz2>, NOAA web site data processed by David Flater for 'XTide'. The code to calculate tide heights from the harmonics is based on 'XTide'.
Maintained by Luke Miller. Last updated 4 months ago.
0.5 match 14 stars 5.43 score 32 scripts
hongooi73
SAR:Smart Adaptive Recommendations
'Smart Adaptive Recommendations' (SAR) is the name of a fast, scalable, adaptive algorithm for personalized recommendations based on user transactions and item descriptions. It produces easily explainable/interpretable recommendations and handles "cold item" and "semi-cold user" scenarios. This package provides two implementations of 'SAR': a standalone implementation, and an interface to a web service in Microsoft's 'Azure' cloud: <https://github.com/Microsoft/Product-Recommendations/blob/master/doc/sar.md>. The former allows fast and easy experimentation, and the latter provides robust scalability and extra features for production use.
Maintained by Hong Ooi. Last updated 4 years ago.
0.5 match 21 stars 5.32 score 20 scripts
daroczig
binancer:API Client to 'Binance'
R client to the 'Binance' Public Rest API for data collection on cryptocurrencies, portfolio management and trading: <https://github.com/binance/binance-spot-api-docs/blob/master/rest-api.md>.
Maintained by Gergely Daróczi. Last updated 1 years ago.
apibinancebinance-apibitcoinblockchaincryptocurrency
0.5 match 53 stars 5.11 score 49 scripts
mikemahoney218
proceduralnames:Several Methods for Procedural Name Generation
A small, dependency-free way to generate random names. Methods provided include the adjective-surname approach of Docker containers ('<https://github.com/moby/moby/blob/master/pkg/namesgenerator/names-generator.go>'), and combinations of common English or Spanish words.
Maintained by Michael Mahoney. Last updated 3 years ago.
0.5 match 7 stars 4.62 score 4 scripts 4 dependentsbioc
saseR:Scalable Aberrant Splicing and Expression Retrieval
saseR is a highly performant and fast framework for aberrant expression and splicing analyses. The main functions are: \itemize{ \item \code{\link{BamtoAspliCounts}} - Process BAM files to ASpli counts \item \code{\link{convertASpli}} - Get gene, bin or junction counts from ASpli SummarizedExperiment \item \code{\link{calculateOffsets}} - Create an offsets assays for aberrant expression or splicing analysis \item \code{\link{saseRfindEncodingDim}} - Estimate the optimal number of latent factors to include when estimating the mean expression \item \code{\link{saseRfit}} - Parameter estimation of the negative binomial distribution and compute p-values for aberrant expression and splicing } For information upon how to use these functions, check out our vignette at \url{https://github.com/statOmics/saseR/blob/main/vignettes/Vignette.Rmd} and the saseR paper: Segers, A. et al. (2023). Juggling offsets unlocks RNA-seq tools for fast scalable differential usage, aberrant splicing and expression analyses. bioRxiv. \url{https://doi.org/10.1101/2023.06.29.547014}.
Maintained by Alexandre Segers. Last updated 5 months ago.
differentialexpressiondifferentialsplicingregressiongeneexpressionalternativesplicingrnaseqsequencingsoftware
0.5 match 1 stars 4.40 score 1 scripts
vusaverse
vvtermtime:Interface for 'Semestry TermTime' Services
Provides an R interface for interacting with the 'Semestry TermTime' services. It allows users to retrieve scheduling data from the API. see <https://github.com/vusaverse/vvtermtime/blob/main/openapi_7.7.0.pdf> for details.
Maintained by Tomer Iwan. Last updated 10 months ago.
schedulingsemestrytermtimetimetables
0.5 match 3.70 score 5 scripts
terrytangyuan
tfio:Interface to 'TensorFlow IO'
Interface to 'TensorFlow IO', Datasets and filesystem extensions maintained by `TensorFlow SIG-IO` <https://github.com/tensorflow/community/blob/master/sigs/io/CHARTER.md>.
Maintained by Yuan Tang. Last updated 5 years ago.
0.5 match 1 stars 3.45 score 57 scripts
jemus42
tauturri:Get Data Out of 'Tautulli' (Formerly 'PlexPy')
'Tautulli' (<http://tautulli.com>) is a monitoring application for 'Plex' Media Servers (<https://www.plex.tv>) which collects a lot of data about media items and server usage such as play counts. This package interacts with the 'Tautulli' API of any specified server to get said data into R. The 'Tautulli' API documentation is available at <https://github.com/Tautulli/Tautulli/blob/master/API.md>.
Maintained by Lukas Burk. Last updated 1 years ago.
0.5 match 1 stars 3.33 score 43 scriptschristopherkenny
planscorer:Score Redistricting Plans with 'PlanScore'
Provides access to the 'PlanScore' Application Programming Interface (<https://github.com/PlanScore/PlanScore/blob/main/API.md>) for scoring redistricting plans. Allows for upload of plans from block assignment files and shape files. For shapes in memory, such as from 'sf' or 'redist', it processes them to save and upload. Includes tools for tidying responses and saving output from the website.
Maintained by Christopher T. Kenny. Last updated 6 months ago.
0.5 match 3.18 score 3 scripts
tucai
genTS:R Shiny App for Creating Simplified Trial Summary (TS) Domain
Make it easy to create simplified trial summary (TS) domain based on FDA FDA guide <https://github.com/TuCai/phuse/blob/master/inst/examples/07_genTS/www/Simplified_TS_Creation_Guide_v2.pdf>.
Maintained by Hanming Tu. Last updated 3 years ago.
0.5 match 1 stars 2.78 score 12 scripts
granatumx
lilikoi:Metabolomics Personalized Pathway Analysis Tool
A comprehensive analysis tool for metabolomics data. It consists a variety of functional modules, including several new modules: a pre-processing module for normalization and imputation, an exploratory data analysis module for dimension reduction and source of variation analysis, a classification module with the new deep-learning method and other machine-learning methods, a prognosis module with cox-PH and neural-network based Cox-nnet methods, and pathway analysis module to visualize the pathway and interpret metabolite-pathway relationships. References: H. Paul Benton <http://www.metabolomics-forum.com/index.php?topic=281.0> Jeff Xia <https://github.com/cangfengzhe/Metabo/blob/master/MetaboAnalyst/website/name_match.R> Travers Ching, Xun Zhu, Lana X. Garmire (2018) <doi:10.1371/journal.pcbi.1006076>.
Maintained by Lana Garmire. Last updated 2 years ago.
0.5 match 1 stars 2.85 score 14 scripts
bumbanian
isoWater:Discovery, Retrieval, and Analysis of Water Isotope Data
The wiDB...() functions provide an interface to the public API of the wiDB <https://github.com/SPATIAL-Lab/isoWater/blob/master/Protocol.md>: build, check and submit queries, and receive and unpack responses. Data analysis functions support Bayesian inference of the source and source isotope composition of water samples that may have experienced evaporation. Algorithms adapted from Bowen et al. (2018, <doi:10.1007/s00442-018-4192-5>).
Maintained by Gabe Bowen. Last updated 8 months ago.
0.5 match 2.81 score 13 scripts
baseldatascience
smetlite:Read and Write SMET Files
Simple class to hold contents of a SMET file as specified in Bavay (2021) <https://code.wsl.ch/snow-models/meteoio/-/blob/master/doc/SMET_specifications.pdf>. There numerical meteorological measurements are all based on MKS (SI) units and timestamp is standardized to UTC time.
Maintained by Reinhold Koch. Last updated 1 years ago.
0.5 match 2.70 score 1 scripts
samuel-watson
glmmrOptim:Approximate Optimal Experimental Designs Using Generalised Linear Mixed Models
Optimal design analysis algorithms for any study design that can be represented or modelled as a generalised linear mixed model including cluster randomised trials, cohort studies, spatial and temporal epidemiological studies, and split-plot designs. See <https://github.com/samuel-watson/glmmrBase/blob/master/README.md> for a detailed manual on model specification. A detailed discussion of the methods in this package can be found in Watson, Hemming, and Girling (2023) <doi:10.1177/09622802231202379>.
Maintained by Sam Watson. Last updated 10 months ago.
0.5 match 1 stars 2.70 score
tk382
MMVBVS:Missing Multivariate Bayesian Variable Selection
A variable selection tool for multivariate normal variables with missing-at-random values using Bayesian Hierarchical Model. Visualization functions show the posterior distribution of gamma (inclusion variables) and beta (coefficients). Users can also visualize the heatmap of the posterior mean of covariance matrix. Kim, T. Nicolae, D. (2019)<https://github.com/tk382/MMVBVS/blob/master/workingpaper.pdf>. Guan, Y. Stephens, M. (2011)<doi:10.1214/11-AOAS455>.
Maintained by Tae Kim. Last updated 5 years ago.
0.5 match 2.70 score
ericsleifer
factorial2x2:Design and Analysis of a 2x2 Factorial Trial
Used for the design and analysis of a 2x2 factorial trial for a time-to-event endpoint. It performs power calculations and significance testing as well as providing estimates of the relevant hazard ratios and the corresponding 95% confidence intervals. Important reference papers include Slud EV. (1994) <https://www.ncbi.nlm.nih.gov/pubmed/8086609> Lin DY, Gong J, Gallo P, Bunn PH, Couper D. (2016) <DOI:10.1111/biom.12507> Leifer ES, Troendle JF, Kolecki A, Follmann DA. (2020) <https://github.com/EricSLeifer/factorial2x2/blob/master/Leifer%20et%20al.%20paper.pdf>.
Maintained by Eric Leifer. Last updated 5 years ago.
0.5 match 2.70 scorecran
DBCVindex:Calculates the Density-Based Clustering Validation (DBCV) Index
A metric called 'Density-Based Clustering Validation index' (DBCV) index to evaluate clustering results, following the <https://github.com/pajaskowiak/clusterConfusion/blob/main/R/dbcv.R> 'R' implementation by Pablo Andretta Jaskowiak. Original 'DBCV' index article: Moulavi, D., Jaskowiak, P. A., Campello, R. J., Zimek, A., and Sander, J. (April 2014), "Density-based clustering validation", Proceedings of SDM 2014 -- the 2014 SIAM International Conference on Data Mining (pp. 839-847), <doi:10.1137/1.9781611973440.96>.
Maintained by Davide Chicco. Last updated 25 days ago.
0.5 match 2.48 score 2 scripts
armando-d
plusCode2:Coordinates to 'Plus Code' Conversion Tool
Generates 'Plus Code' of geometric objects or data frames that contain them, giving the possibility to specify the precision of the area. The main feature of the package comes from the open-source code developed by 'Google Inc.' present in the repository <https://github.com/google/open-location-code/blob/main/java/src/main/java/com/google/openlocationcode/OpenLocationCode.java>. For details about 'Plus Code', visit <https://maps.google.com/pluscodes/> or <https://github.com/google/open-location-code>.
Maintained by Armando dAniello. Last updated 12 months ago.
0.5 match 2.30 score
semipublicdlf
shinycroneditor:'shiny' Cron Expression Input Widget
A widget for 'shiny' apps to handle schedule expression input, using the 'cron-expression-input' JavaScript component. Note that this does not edit the 'crontab' file, it is just an input element for the schedules. See <https://github.com/DatalabFabriek/shinycroneditor/blob/main/inst/examples/shiny-app.R> for an example implementation.
Maintained by Harmen van der Veer. Last updated 6 months ago.
0.5 match 1.70 score 3 scriptscran
RegCombin:Partially Linear Regression under Data Combination
We implement linear regression when the outcome of interest and some of the covariates are observed in two different datasets that cannot be linked, based on D'Haultfoeuille, Gaillac, Maurel (2022) <doi:10.3386/w29953>. The package allows for common regressors observed in both datasets, and for various shape constraints on the effect of covariates on the outcome of interest. It also provides the tools to perform a test of point identification. See the associated vignette <https://github.com/cgaillac/RegCombin/blob/master/RegCombin_vignette.pdf> for theory and code examples.
Maintained by Christophe Gaillac. Last updated 1 years ago.
0.5 match 1 stars 1.00 score
bixiou
HighestMedianRules:Implementation of Voting Rules Electing the Candidate with Highest Median Grade
Computes the scores and ranks candidates according to voting rules electing the highest median grade. Based on "Tie-breaking the highest median: alternatives to the majority judgment", A. Fabre, Social Choice & Welfare (forthcoming as of 2020). The paper is available here: <https://github.com/bixiou/highest_median/raw/master/Tie-breaking%20Highest%20Median%20-%20Fabre%202019.pdf>. Functions to plot the voting profiles can be found on github: <https://github.com/bixiou/highest_median/blob/master/packages_functions_data.R>.
Maintained by Adrien Fabre. Last updated 5 years ago.
0.5 match 1.00 score
rahmasarina
NMTox:Dose-Response Relationship Analysis of Nanomaterial Toxicity
Perform an exploration and a preliminary analysis on the dose- response relationship of nanomaterial toxicity. Several functions are provided for data exploration, including functions for creating a subset of dataset, frequency tables and plots. Inference for order restricted dose- response data is performed by testing the significance of monotonic dose-response relationship, using Williams, Marcus, M, Modified M and Likelihood ratio tests. Several methods of multiplicity adjustment are also provided. Description of the methods can be found in <https://github.com/rahmasarina/dose-response-analysis/blob/main/Methodology.pdf>.
Maintained by Rahmasari Nur Azizah. Last updated 3 years ago.
0.5 match 1.00 score